From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002609000
  • symbol?: opuBA
  • description?: choline transport ATP-binding protein

      descriptions from strain specific annotations:

    • choline transport ATP-binding protein
    • osmoprotectant ABC transporter, ATP-binding protein, putative
    • Glycine betaine ABC transport system, ATP-binding protein OpuAA
    • choline transport ATP-binding protein opuBA. domain protein
    • osmoprotectant ABC transporter ATP-binding protein
    • putative osmoprotectant ABC transporter ATP-binding protein
    • glycine betaine/carnitine/choline ABC transporter ATP-binding protein
    • glycine/betaine/carnitine/choline ABC superfamily ATP binding cassette transporter, ABC protein
    • Osmoprotectant ABC transporter, ATP-binding protein
    • ABC transporter family protein
    • glycine betaine transport ATP-binding protein
    • glycine betaine/carnitine/choline ATP-binding ABC transport protein
  • strand?: +
  • coordinates?: 3120378..3121355
  • synteny block?: BlockID0018450
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0699
    08BA02176:
    C248_0807
    11819-97:
    MS7_0773
    71193:
    ST398NM01_0799
    ECT-R 2:
    ECTR2_672
    ED133:
    SAOV_0756
    ED98:
    SAAV_0683
    HO 5096 0412:
    SAEMRSA15_06480
    JH1:
    SaurJH1_0762
    JH9:
    SaurJH9_0745
    JKD6008:
    SAA6008_00737
    JKD6159:
    SAA6159_00676
    LGA251:
    SARLGA251_06550
    M013:
    M013TW_0708
    MRSA252:
    SAR0775
    MSHR1132:
    SAMSHR1132_06670
    MSSA476:
    SAS0687
    Mu3:
    SAHV_0719
    Mu50:
    SAV0722
    MW2:
    MW0684
    RF122:
    SAB0671
    ST398:
    SAPIG0799
    T0131:
    SAT0131_00791
    TCH60:
    HMPREF0772_12465
    TW20:
    SATW20_07970
    USA300_TCH1516:
    USA300HOU_0745
    VC40:
    SAVC_03240

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIKFKNVTKRYGKHVAVDNISFNINEGEFFVLIGPSGCGKTTTLKMINRLIHLSEGYIYF
    N315            MIKFKNVTKRYGKHVAVDNISFNINEGEFFVLIGPSGCGKTTTLKMINRLIHLSEGYIYF
    NCTC8325        MIKFKNVTKRYGKHVAVDNISFNINEGEFFVLIGPSGCGKTTTLKMINRLIHLSEGYIYF
    Newman          MIKFKNVTKRYGKHVAVDNISFNINEGEFFVLIGPSGCGKTTTLKMINRLIHLSEGYIYF
    USA300_FPR3757  MIKFKNVTKRYGKHVAVDNISFNINEGEFFVLIGPSGCGKTTTLKMINRLIHLSEGYIYF
                    ************************************************************

    COL             KDKPISDYPVYEMRWDIGYVLQQIALFPHMTIKENIAQVPQMKKWKEKDIDKRVDELLEM
    N315            KDKPISDYPVYEMRWDIGYVLQQIALFPHMTIKENIAQVPQMKKWKEKDIDKRVDELLDM
    NCTC8325        KDKPISDYPVYEMRWDIGYVLQQIALFPHMTIKENIAQVPQMKKWKEKDIDKRVDELLEM
    Newman          KDKPISDYPVYEMRWDIGYVLQQIALFPHMTIKENIAQVPQMKKWKEKDIDKRVDELLEM
    USA300_FPR3757  KDKPISDYPVYEMRWDIGYVLQQIALFPHMTIKENIAQVPQMKKWKEKDIDKRVDELLEM
                    **********************************************************:*

    COL             VGLEPEKYKNRKPDELSGGQRQRVGVIRALAADPPVILMDEPFSALDPISREKLQDDLIE
    N315            VGLEPEKYKNRKPDELSGGQRQRVGVIRALAADPPVILMDEPFSALDPISREKLQDDLIE
    NCTC8325        VGLEPEKYKNRKPDELSGGQRQRVGVIRALAADPPVILMDEPFSALDPISREKLQDDLIE
    Newman          VGLEPEKYKNRKPDELSGGQRQRVGVIRALAADPPVILMDEPFSALDPISREKLQDDLIE
    USA300_FPR3757  VGLEPEKYKNRKPDELSGGQRQRVGVIRALAADPPVILMDEPFSALDPISREKLQDDLIE
                    ************************************************************

    COL             LQTKIKKAIIFVTHDIQEAMKLGDKICLLNEGHIEQIDTPEGFKNNPQSEFVKQFMGSHL
    N315            LQTKIKKTIIFVTHDIQEAMKLGDKICLLNEGHIEQIDTPEGFKNNPQSEFVKQFMGSHL
    NCTC8325        LQTKIKKTIIFVTHDIQEAMKLGDKICLLNEGHIEQIDTPEGFKNNPQSEFVKQFMGSHL
    Newman          LQTKIKKTIIFVTHDIQEAMKLGDKICLLNEGHIEQIDTPEGFKNNPQSEFVKQFMGSHL
    USA300_FPR3757  LQTKIKKTIIFVTHDIQEAMKLGDKICLLNEGHIEQIDTPEGFKNNPQSEFVKQFMGSHL
                    *******:****************************************************

    COL             EDDAPCVEENAIIRDLDIMKPIDEVTSMSAYPIVYDNQPIEVLYQLLSESERVIVMQEDS
    N315            EDDAPCVEENAIIRDLDIMKPIDEVTSMSAYPIVYDNQPIEVLYQHLSESERVIVMQEDS
    NCTC8325        EDDAPCVEENAIIRDLDIMKPIDEVTSMSAYPIVYDNQPIEVLYQLLSESERVIVMQEDS
    Newman          EDDAPCVEENAIIRDLDIMKPIDEVTSMSAYPIVYDNQPIEVLYQLLSESERVIVMQEDS
    USA300_FPR3757  EDDAPCVEENAIIRDLDIMKPIDEVTSMSAYPIVYDNQPIEVLYQLLSESERVIVMQEDS
                    ********************************************* **************

    COL             VGQYVIDRKDIFKYLSQKKEVAQHD
    N315            VGQYVIDRKDIFKYLSQKKEVAQHD
    NCTC8325        VGQYVIDRKDIFKYLSQKKEVAQHD
    Newman          VGQYVIDRKDIFKYLSQKKEVAQHD
    USA300_FPR3757  VGQYVIDRKDIFKYLSQKKEVAQHD
                    *************************