From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002614000
  • symbol?:
  • description?: 5'-3'-deoxyribonucleotidase

      descriptions from strain specific annotations:

    • 5'-3'-deoxyribonucleotidase
    • Putative 5(3)-deoxyribonucleotidase
    • 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C) family protein
    • 5 nucleotidase, deoxy, cytosolic type C
    • hydrolase
  • strand?: +
  • coordinates?: 3124939..3125705
  • synteny block?: BlockID0018500
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0703
    08BA02176:
    C248_0810
    11819-97:
    MS7_0776
    71193:
    ST398NM01_0802
    ECT-R 2:
    ECTR2_675
    ED133:
    SAOV_0760
    ED98:
    SAAV_0686
    HO 5096 0412:
    SAEMRSA15_06510
    JH1:
    SaurJH1_0765
    JH9:
    SaurJH9_0748
    JKD6008:
    SAA6008_00740
    JKD6159:
    SAA6159_00679
    LGA251:
    SARLGA251_06580
    M013:
    M013TW_0711
    MRSA252:
    SAR0778
    MSHR1132:
    SAMSHR1132_06700
    MSSA476:
    SAS0690
    Mu3:
    SAHV_0722
    Mu50:
    SAV0725
    MW2:
    MW0687
    RF122:
    SAB0674
    ST398:
    SAPIG0802
    T0131:
    SAT0131_00794
    TCH60:
    HMPREF0772_12462
    TW20:
    SATW20_08000
    USA300_TCH1516:
    USA300HOU_0748
    VC40:
    SAVC_03260

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTRKSIAIDMDEVLADTLGEIIDAVNFRADLGIKMEALNGQKLKHVIPEHDGLITEVLRE
    N315            MTRKSIAIDMDEVLADTLGEIIDAVNFRADLGIKMEALNGQKLKHVIPEHDGLITEVLRE
    NCTC8325        MTRKSIAIDMDEVLADTLGEIIDAVNFRADLGIKMEALNGQKLKHVIPEHDGLITEVLRE
    Newman          MTRKSIAIDMDEVLADTLGEIIDAVNFRADLGIKMEALNGQKLKHVIPEHDGLITEVLRE
    USA300_FPR3757  MTRKSIAIDMDEVLADTLGEIIDAVNFRADLGIKMEALNGQKLKHVIPEHDGLITEVLRE
                    ************************************************************

    COL             PGFFRHLKVMPYAQEVVKKLTEHYDVYIATAAMDVPTSFSDKYEWLLEFFPFLDPQHFVF
    N315            PGFFRHLKVMPHAQEVVKKLTEHYDVYIATAAMDVPTSFSDKYEWLLEFFPFLDPQHFVF
    NCTC8325        PGFFRHLKVMPYAQEVVKKLTEHYDVYIATAAMDVPTSFSDKYEWLLEFFPFLDPQHFVF
    Newman          PGFFRHLKVMPYAQEVVKKLTEHYDVYIATAAMDVPTSFSDKYEWLLEFFPFLDPQHFVF
    USA300_FPR3757  SGFFRHLKVMPYAQEVVKKLTEHYDVYIATAAMDVPTSFSDKYEWLLEFFPFLDPQHFVF
                    .**********:************************************************

    COL             CGRKNIVKADYLIDDNPRQLEIFTGTPIMFTAVHNINDDRFERVNSWKDVEQYFLDNIEK
    N315            CGRKNIVKADYLIDDNPRQLEIFTGTPIMFTAVHNINDDRFERVNSWKDVEQYFLDNIEK
    NCTC8325        CGRKNIVKADYLIDDNPRQLEIFTGTPIMFTAVHNINDDRFERVNSWKDVEQYFLDNIEK
    Newman          CGRKNIVKADYLIDDNPRQLEIFTGTPIMFTAVHNINDDRFERVNSWKDVEQYFLDNIEK
    USA300_FPR3757  CGRKNIVKADYLIDDNPRQLEIFTGTPIMFTAVHNINDDRFERVNSWKDVEQYFLDNIEK
                    ************************************************************