From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002621000
  • symbol?: bmrU
  • description?: lipid kinase

      descriptions from strain specific annotations:

    • lipid kinase
    • putative lipid kinase
    • diacylglycerol kinase catalytic domain (presumed) family protein
    • diacylglycerol kinase catalytic subunit
    • lipid kinase, YegS/Rv2252/BmrU family protein
    • multidrug resistance protein
    • putative diacylglycerol kinase protein
    • transcription regulator
    • Transcription regulator (contains diacylglycerol kinase catalytic domain)
    • YegS/Rv2252/BmrU family lipid kinase
  • strand?: -
  • coordinates?: 3127089..3128094
  • synteny block?: BlockID0018560
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0704
    08BA02176:
    C248_0812
    11819-97:
    MS7_0777
    71193:
    ST398NM01_0803
    ECT-R 2:
    ECTR2_676
    ED133:
    SAOV_0761c
    ED98:
    SAAV_0687
    HO 5096 0412:
    SAEMRSA15_06520
    JH1:
    SaurJH1_0766
    JH9:
    SaurJH9_0749
    JKD6008:
    SAA6008_00741
    JKD6159:
    SAA6159_00681
    LGA251:
    SARLGA251_06590
    M013:
    M013TW_0712
    MRSA252:
    SAR0780
    MSHR1132:
    SAMSHR1132_06710
    MSSA476:
    SAS0691
    Mu3:
    SAHV_0723
    Mu50:
    SAV0726
    MW2:
    MW0688
    RF122:
    SAB0675c
    ST398:
    SAPIG0803
    T0131:
    SAT0131_00795
    TCH60:
    HMPREF0772_12460 (bmrU)
    TW20:
    SATW20_08010
    USA300_TCH1516:
    USA300HOU_0749 (dgkA1)
    VC40:
    SAVC_03265

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MENKYTHGVLFYHEHSGLKNINQGIGEVTTALSSICKHLSIQLSENEGDIIKYCQEIKTK
    N315            MENKYTHGVLFYHEHSGLKNINQGIGEVTTALSSICKHLSIQLSENEGDIIKYCQEIKTK
    NCTC8325        MENKYTHGVLFYHEHSGLKNINQGIGEVTTALSSICKHLSIQLSENEGDIIKYCQEIKTK
    Newman          MENKYTHGVLFYHEHSGLKNINQGIGEVTTALSSICKHLSIQLSENEGDIIKYCQEIKTK
    USA300_FPR3757  MENKYTHGVLFYHEHSGLKNINQGIGEVTTALSSICKHLSIQLSENEGDIIKYCQEIKTK
                    ************************************************************

    COL             NYAKDVDILFILGGDGTVNELINGVMTHDLQLPIGILPGGTFNDFTKTLNIAPNHKQASE
    N315            NYAKDVDILFILGGDGTVNELINGVMSHDLQLPIGILPGGTFNDFTKTLNIAPNHKQASE
    NCTC8325        NYAKDVDILFILGGDGTVNELINGVMTHDLQLPIGILPGGTFNDFTKTLNIAPNHKQASE
    Newman          NYAKDVDILFILGGDGTVNELINGVMTHDLQLPIGILPGGTFNDFTKTLNIAPNHKQASE
    USA300_FPR3757  NYAKDVDILFILGGDGTVNELINGVMTHDLQLPIGILPGGTFNDFTKTLNIAPNHKQASE
                    **************************:*********************************

    COL             QMISAQVGTYDVIKINNQYALNFVGLGLIVQNAENVQDGSKDIFGKLSYIGSTVKTLLNP
    N315            QMISAQVGTYDVIKINNQYALNFVGLGLIVQNAENVQDGSKDIFGKLSYIGSTVKTLLNP
    NCTC8325        QMISAQVGTYDVIKINNQYALNFVGLGLIVQNAENVQDGSKDIFGKLSYIGSTVKTLLNP
    Newman          QMISAQVGTYDVIKINNQYALNFVGLGLIVQNAENVQDGSKDIFGKLSYIGSTVKTLLNP
    USA300_FPR3757  QMISAQVGTYDVIKINNQYALNFVGLGLIVQNAENVQDGSKDIFGKLSYIGSTVKTLLNP
                    ************************************************************

    COL             TQFNYQLSIDDKTYSGETTMILTANGPFIGGSRIPLTDLSPQDGELNTFIFNEQSFSILN
    N315            TQFNYQLSIDDKTYSGETTMILTANGPFIGGSRIPLTDLSPQDGELNTFIFNEQSFSILN
    NCTC8325        TQFNYQLSIDDKTYSGETTMILTANGPFIGGSRIPLTDLSPQDGELNTFIFNEQSFSILN
    Newman          TQFNYQLSIDDKTYSGETTMILTANGPFIGGSRIPLTDLSPQDGELNTFIFNEQSFSILN
    USA300_FPR3757  TQFNYQLSIDDKTYSGETTMILTANGPFIGGSRIPLTDLSPQDGELNTFIFNEQSFSILN
                    ************************************************************

    COL             DIFKKRDSMNWNEITQGIEHIPGKKISLTTDPAMKVDIDGEISLETPIDIEVIPNAIQLL
    N315            DIFKKRDSMNWNEITQGIEHIPGKKISLTTDPAMKVDIDGEISLETPIDIEVIPNAIQLL
    NCTC8325        DIFKKRDSMNWNEITQGIEHIPGKKISLTTDPAMKVDIDGEISLETPIDIEVIPNAIQLL
    Newman          DIFKKRDSMNWNEITQGIEHIPGKKISLTTDPAMKVDIDGEISLETPIDIEVIPNAIQLL
    USA300_FPR3757  DIFKKRDSMNWNEITQGIEHIPGKKISLTTDPAMKVDIDGEISLETPIDIEVIPNAIQLL
                    ************************************************************

    COL             TVNDL
    N315            TVNDL
    NCTC8325        TVNDL
    Newman          TVNDL
    USA300_FPR3757  TVNDL
                    *****