From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002629000
  • symbol?: nrdI
  • description?: ribonucleotide reductase stimulatory protein

      descriptions from strain specific annotations:

    • ribonucleotide reductase stimulatory protein
    • ribonucleotide reduction protein NrdI
    • protein nrdI
    • NrdI protein involved in ribonucleotide reductase function
    • nrdI protein
    • ribonucleotide-diphosphate reductase subunit gamma
    • Nrdi
  • strand?: +
  • coordinates?: 3132869..3133288
  • synteny block?: BlockID0018640
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0791 (nrdI)
    N315:
    SA0685 (nrdI)
    NCTC8325:
    Newman:
    NWMN_0699 (nrdI)
    USA300_FPR3757:
    04-02981:
    SA2981_0708 (nrdI)
    08BA02176:
    C248_0817
    11819-97:
    MS7_0781 (nrdI)
    71193:
    ST398NM01_0807
    ECT-R 2:
    ECTR2_680 (nrdI)
    ED133:
    SAOV_0766
    ED98:
    SAAV_0692 (nrdI)
    HO 5096 0412:
    SAEMRSA15_06560
    JH1:
    SaurJH1_0771 (nrdI)
    JH9:
    SaurJH9_0754 (nrdI)
    JKD6008:
    SAA6008_00745 (nrdI)
    JKD6159:
    SAA6159_00685 (nrdI)
    LGA251:
    SARLGA251_06630 (nrdI)
    M013:
    M013TW_0716
    MRSA252:
    SAR0784 (nrdI)
    MSHR1132:
    SAMSHR1132_06750
    MSSA476:
    SAS0695 (nrdI)
    Mu3:
    SAHV_0727 (nrdI)
    Mu50:
    SAV0730 (nrdI)
    MW2:
    MW0692 (nrdI)
    RF122:
    SAB0681 (nrdI)
    ST398:
    SAPIG0807 (nrdI)
    T0131:
    SAT0131_00800
    TCH60:
    HMPREF0772_12454 (nrdI)
    TW20:
    SATW20_08050 (nrdI)
    USA300_TCH1516:
    USA300HOU_0754 (nrdI)
    VC40:
    SAVC_03285 (nrdI)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIIYFSFTGNVRRFIKRTELENTLEITAENCMEPVHEPFIIVTGTIGFGEVPEPVQSFL
    N315            MKIIYFSFTGNVRRFIKRTELENTLEITAENCMEPVHEPFIIVTGTIGFGEVPEPVQSFL
    NCTC8325        MKIIYFSFTGNVRRFIKRTELENTLEITAENCMEPVHEPFIIVTGTIGFGEVPEPVQSFL
    Newman          MKIIYFSFTGNVRRFIKRTELENTLEITAENCMEPVHEPFIIVTGTIGFGEVPEPVQSFL
    USA300_FPR3757  MKIIYFSFTGNVRRFIKRTELENTLEITAENCMEPVHEPFIIVTGTIGFGEVPEPVQSFL
                    ************************************************************

    COL             EVNHQYIRGVAASGNRNWGLNFAKAGRTISEEYNVPLLMKFELHGKNKDVIEFKNKVGNF
    N315            EVNHQYIRGVAASGNRNWGLNFAKAGRTISEEYNVPLLMKFELHGKNKDVIEFKNKVGNF
    NCTC8325        EVNHQYIRGVAASGNRNWGLNFAKAGRTISEEYNVPLLMKFELHGKNKDVIEFKNKVGNF
    Newman          EVNHQYIRGVAASGNRNWGLNFAKAGRTISEEYNVPLLMKFELHGKNKDVIEFKNKVGNF
    USA300_FPR3757  EVNHQYIRGVAASGNRNWGLNFAKAGRTISEEYNVPLLMKFELHGKNKDVIEFKNKVGNF
                    ************************************************************

    COL             NENHGREKVQSY
    N315            NENHGREKVQSY
    NCTC8325        NENHGREKVQSY
    Newman          NENHGREKVQSY
    USA300_FPR3757  NENHGREKVQSY
                    ************