From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002630000
  • symbol?: nrdE
  • description?: ribonucleotide-diphosphate reductase subunit alpha

      descriptions from strain specific annotations:

    • ribonucleotide-diphosphate reductase subunit alpha
    • Ribonucleotide reductase of class Ib (aerobic), alpha subunit
    • ribonucleoside-diphosphate reductase, alpha subunit
    • Ribonucleoside-diphosphate reductase, large chain
    • ribonucleoside-diphosphate reductase alphachain
    • ribonucleoside-diphosphate reductase subunit alpha
  • strand?: +
  • coordinates?: 3133191..3135356
  • synteny block?: BlockID0018650
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0792 (nrdE)
    N315:
    SA0686 (nrdE)
    NCTC8325:
    Newman:
    NWMN_0700 (nrdE)
    USA300_FPR3757:
    04-02981:
    SA2981_0709 (nrdE)
    08BA02176:
    C248_0818 (nrdE)
    11819-97:
    MS7_0782
    71193:
    ST398NM01_0808
    ECT-R 2:
    ECTR2_681
    ED133:
    SAOV_0767
    ED98:
    SAAV_0693 (nrdE)
    HO 5096 0412:
    SAEMRSA15_06570 (rir1)
    JH1:
    SaurJH1_0772
    JH9:
    SaurJH9_0755
    JKD6008:
    SAA6008_00746 (nrdE)
    JKD6159:
    SAA6159_00686 (nrdE)
    LGA251:
    SARLGA251_06640 (rir1)
    M013:
    M013TW_0717
    MRSA252:
    SAR0785 (rir1)
    MSHR1132:
    SAMSHR1132_06760
    MSSA476:
    SAS0696
    Mu3:
    SAHV_0728 (nrdE)
    Mu50:
    SAV0731 (nrdE)
    MW2:
    MW0693 (nrdE)
    RF122:
    SAB0682 (rir1)
    ST398:
    SAPIG0808
    T0131:
    SAT0131_00801
    TCH60:
    HMPREF0772_12453 (nrdE)
    TW20:
    SATW20_08060 (rir1)
    USA300_TCH1516:
    USA300HOU_0755 (nrdE)
    VC40:
    SAVC_03290

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --------------------MKTMEEKKYNHIELNNEVTKRREDGFFSLEKDQEALVAYL
    N315            ---MEKTKTLLNLRTRWVILMKTMEEKKYNHIELNNEVTKRREDGFFSLEKDQEALVAYL
    NCTC8325        MSYMEKTKTLLNLRTRWVILMKTMEEKKYNHIELNNEVTKRREDGFFSLEKDQEALVAYL
    Newman          ---MEKTKTLLNLRTRWVILMKTMEEKKYNHIELNNEVTKRREDGFFSLEKDQEALVAYL
    USA300_FPR3757  --------------------MKTMEEKKYNHIELNNEVTKRREDGFFSLEKDQEALVAYL
                                        ****************************************

    COL             EEVKDKTIFFDTEIERLRYLVDNDFYFNVFDIYSEADLIEITDYAKSIPFNFASYMSASK
    N315            EEVKDKTIFFDTEIERLRYLVDNDFYFNVFDIYSEADLIEITDYAKSISFNFASYMSASK
    NCTC8325        EEVKDKTIFFDTEIERLRYLVDNDFYFNVFDIYSEADLIEITDYAKSIPFNFASYMSASK
    Newman          EEVKDKTIFFDTEIERLRYLVDNDFYFNVFDIYSEADLIEITDYAKSIPFNFASYMSASK
    USA300_FPR3757  EEVKDKTIFFDTEIERLRYLVDNDFYFNVFDIYSEADLIEITDYAKSIPFNFASYMSASK
                    ************************************************.***********

    COL             FFKDYALKTNDKSQYLEDYNQHVAIVALYLANGNKAQAKQFISAMVEQRYQPATPTFLNA
    N315            FFKDYALKTNDKSQYLEDYNQHVAIVALYLANGNKAQAKQFISAMVEQRYQPATPTFLNA
    NCTC8325        FFKDYALKTNDKSQYLEDYNQHVAIVALYLANGNKAQAKQFISAMVEQRYQPATPTFLNA
    Newman          FFKDYALKTNDKSQYLEDYNQHVAIVALYLANGNKAQAKQFISAMVEQRYQPATPTFLNA
    USA300_FPR3757  FFKDYALKTNDKSQYLEDYNQHVAIVALYLANGNKAQAKQFISAMVEQRYQPATPTFLNA
                    ************************************************************

    COL             GRARRGELVSCFLLEVDDSLNSINFIDSTAKQLSKIGGGVAINLSKLRARGEAIKGIKGV
    N315            GRARRGELVSCFLLEVDDSLNSINFIDSTAKQLSKIGGGVAINLSKLRARGEAIKGIKGV
    NCTC8325        GRARRGELVSCFLLEVDDSLNSINFIDSTAKQLSKIGGGVAINLSKLRARGEAIKGIKGV
    Newman          GRARRGELVSCFLLEVDDSLNSINFIDSTAKQLSKIGGGVAINLSKLRARGEAIKGIKGV
    USA300_FPR3757  GRARRGELVSCFLLEVDDSLNSINFIDSTAKQLSKIGGGVAINLSKLRARGEAIKGIKGV
                    ************************************************************

    COL             AKGVLPIAKSLEGGFSYADQLGQRPGAGAVYLNIFHYDVEEFLDTKKVNADEDLRLSTIS
    N315            AKGVLPIAKSLEGGFSYADQLGQRPGAGAVYLNIFHYDVEEFLDTKKVNADEDLRLSTIS
    NCTC8325        AKGVLPIAKSLEGGFSYADQLGQRPGAGAVYLNIFHYDVEEFLDTKKVNADEDLRLSTIS
    Newman          AKGVLPIAKSLEGGFSYADQLGQRPGAGAVYLNIFHYDVEEFLDTKKVNADEDLRLSTIS
    USA300_FPR3757  AKGVLPIAKSLEGGFSYADQLGQRPGAGAVYLNIFHYDVEEFLDTKKVNADEDLRLSTIS
                    ************************************************************

    COL             TGLIVPSKFFDLAKEGKDFYMFAPHTVKEEYGVTLDDIDLEKYYDDMVANPNVEKKKKNA
    N315            TGLIVPSKFFDLAKEGKDFYMFAPHTVKEEYGVTLDDIDLEKYYDDMVANPNVEKKKKNA
    NCTC8325        TGLIVPSKFFDLAKEGKDFYMFAPHTVKEEYGVTLDDIDLEKYYDDMVANPNVEKKKKNA
    Newman          TGLIVPSKFFDLAKEGKDFYMFAPHTVKEEYGVTLDDIDLEKYYDDMVANPNVEKKKKNA
    USA300_FPR3757  TGLIVPSKFFDLAKEGKDFYMFAPHTVKEEYGVTLDDIDLEKYYDDMVANPNVEKKKKNA
                    ************************************************************

    COL             REMLNLIAQTQLQSGYPYLMFKDNANRVHPNSNIGQIKMSNLCTEIFQLQETSIINDYGI
    N315            REMLNLIAQTQLQSGYPYLMFKDNANRVHPNSNIGQIKMSNLCTEIFQLQETSIINDYGI
    NCTC8325        REMLNLIAQTQLQSGYPYLMFKDNANRVHPNSNIGQIKMSNLCTEIFQLQETSIINDYGI
    Newman          REMLNLIAQTQLQSGYPYLMFKDNANRVHPNSNIGQIKMSNLCTEIFQLQETSIINDYGI
    USA300_FPR3757  REMLNLIAQTQLQSGYPYLMFKDNANRVHPNSNIGQIKMSNLCTEIFQLQETSIINDYGI
                    ************************************************************

    COL             EDEIKRDISCNLGSLNIVNVMESGKFRDSVHSGMDALTVVSDVANIQNAPGVRKANSELH
    N315            EDEIKRDISCNLGSLNIVNVMESGKFRDSVHSGMDALTVVSDVANIQNAPGVRKANSELH
    NCTC8325        EDEIKRDISCNLGSLNIVNVMESGKFRDSVHSGMDALTVVSDVANIQNAPGVRKANSELH
    Newman          EDEIKRDISCNLGSLNIVNVMESGKFRDSVHSGMDALTVVSDVANIQNAPGVRKANSELH
    USA300_FPR3757  EDEIKRDISCNLGSLNIVNVMESGKFRDSVHSGMDALTVVSDVANIQNAPGVRKANSELH
                    ************************************************************

    COL             SVGLGVMNLHGYLAKNKIGYESEEAKDFANIFFMMMNFYSIERSMEIAKERGIKYQDFEK
    N315            SVGLGVMNLHGYLAKNKIGYESEEAKDFANIFFMMMNFYSIERSMEIAKERGIKYQDFEK
    NCTC8325        SVGLGVMNLHGYLAKNKIGYESEEAKDFANIFFMMMNFYSIERSMEIAKERGIKYQDFEK
    Newman          SVGLGVMNLHGYLAKNKIGYESEEAKDFANIFFMMMNFYSIERSMEIAKERGIKYQDFEK
    USA300_FPR3757  SVGLGVMNLHGYLAKNKIGYESEEAKDFANIFFMMMNFYSIERSMEIAKERGIKYQDFEK
                    ************************************************************

    COL             SDYANGKYFEFYTTQEFEPQFEKVRELFDGMAIPTSEDWKKLQQDVEQYGLYHAYRLAIA
    N315            SDYANGKYFEFYTTQEFEPQFEKVRELFDGMAIPTSEDWKKLQQDVEQYGLYHAYRLAIA
    NCTC8325        SDYANGKYFEFYTTQEFEPQFEKVRELFDGMAIPTSEDWKKLQQDVEQYGLYHAYRLAIA
    Newman          SDYANGKYFEFYTTQEFEPQFEKVRELFDGMAIPTSEDWKKLQQDVEQYGLYHAYRLAIA
    USA300_FPR3757  SDYANGKYFEFYTTQEFEPQFEKVRELFDGMAIPTSEDWKKLQQDVEQYGLYHAYRLAIA
                    ************************************************************

    COL             PTQSISYVQNATSSVMPIVDQIERRTYGNAETFYPMPFLSPQTMWYYKSAFNTDQMKLID
    N315            PTQSISYVQNATSSVMPIVDQIERRTYGNAETFYPMPFLSPQTMWYYKSAFNTDQMKLID
    NCTC8325        PTQSISYVQNATSSVMPIVDQIERRTYGNAETFYPMPFLSPQTMWYYKSAFNTDQMKLID
    Newman          PTQSISYVQNATSSVMPIVDQIERRTYGNAETFYPMPFLSPQTMWYYKSAFNTDQMKLID
    USA300_FPR3757  PTQSISYVQNATSSVMPIVDQIERRTYGNAETFYPMPFLSPQTMWYYKSAFNTDQMKLID
                    ************************************************************

    COL             LIATIQTHIDQGISTILYVNSEISTRELARLYVYAHYKGLKSLYYTRNKLLSVEECTSCS
    N315            LIATIQTHIDQGISTILYVNSEISTRELARLYVYAHYKGLKSLYYTRNKLLSVEECTSCS
    NCTC8325        LIATIQTHIDQGISTILYVNSEISTRELARLYVYAHYKGLKSLYYTRNKLLSVEECTSCS
    Newman          LIATIQTHIDQGISTILYVNSEISTRELARLYVYAHYKGLKSLYYTRNKLLSVEECTSCS
    USA300_FPR3757  LIATIQTHIDQGISTILYVNSEISTRELARLYVYAHYKGLKSLYYTRNKLLSVEECTSCS
                    ************************************************************

    COL             I
    N315            I
    NCTC8325        I
    Newman          I
    USA300_FPR3757  I
                    *