From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002638000
  • symbol?: sstB
  • description?: iron ABC transporter permease

      descriptions from strain specific annotations:

    • iron ABC transporter permease
    • iron compound ABC transporter permease
    • fecCD transport family protein
    • transport system permease protein
    • ABC transporter, iron chelate uptake transporter (FeCT) family, permease protein
    • FatC
    • FecCD family ferrichrome ATP-binding ABC transporter
    • ferrichrome ABC transporter permease
    • iron (Fe+3) ABC superfamily ATP binding cassette transporter, membrane protein
    • iron (Fe+3) ABC transporter membrane protein
    • iron compound ABC transporter, permease protein
    • Iron compound ABC uptake transporter permease protein
  • strand?: +
  • coordinates?: 3138416..3139373
  • synteny block?: BlockID0018730
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0712
    08BA02176:
    C248_0821 (sstB)
    11819-97:
    MS7_0785
    71193:
    ST398NM01_0811
    ECT-R 2:
    ECTR2_685
    ED133:
    SAOV_0771
    ED98:
    SAAV_0696
    HO 5096 0412:
    SAEMRSA15_06600 (sstB)
    JH1:
    SaurJH1_0775
    JH9:
    SaurJH9_0758
    JKD6008:
    SAA6008_00749 (sstB)
    JKD6159:
    SAA6159_00690 (sstB)
    LGA251:
    SARLGA251_06670 (sstB)
    M013:
    M013TW_0720
    MRSA252:
    SAR0788 (sstB)
    MSHR1132:
    SAMSHR1132_06790
    MSSA476:
    SAS0699
    Mu3:
    SAHV_0731
    Mu50:
    SAV0734
    MW2:
    MW0696
    RF122:
    SAB0686 (sstB)
    ST398:
    SAPIG0811
    T0131:
    SAT0131_00806
    TCH60:
    HMPREF0772_12450 (sstB)
    TW20:
    SATW20_08090 (sstB)
    USA300_TCH1516:
    USA300HOU_0760
    VC40:
    SAVC_03305

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRNNNKKIMLLIAVTLLISMLYLFVGIDFEIFEYQFSSRLRKFILIILVGAAIATSVVIF
    N315            MRNNNKKIMLLIAVTLLISMLYLFVGIDFEIFEYQFSSRLRKFILIILVGAAIATSVVIF
    NCTC8325        MRNNNKKIMLLIAVTLLISMLYLFVGIDFEIFEYQFSSRLRKFILIILVGAAIATSVVIF
    Newman          MRNNNKKIMLLIAVTLLISMLYLFVGIDFEIFEYQFSSRLRKFILIILVGAAIATSVVIF
    USA300_FPR3757  MRNNNKKIMLLIAVTLLISMLYLFVGIDFEIFEYQFSSRLRKFILIILVGAAIATSVVIF
                    ************************************************************

    COL             QAITNNRLLTPSIMGLDAVYLFIKVLPVFLFGIQSVWVTNVYLNFILTLITMVLFALILF
    N315            QAITNNRLLTPSIMGLDAVYLFIKVLPVFLFGIQSVWVTNVYLNFILTLITMVLFALILF
    NCTC8325        QAITNNRLLTPSIMGLDAVYLFIKVLPVFLFGIQSVWVTNVYLNFILTLITMVLFALILF
    Newman          QAITNNRLLTPSIMGLDAVYLFIKVLPVFLFGIQSVWVTNVYLNFILTLITMVLFALILF
    USA300_FPR3757  QAITNNRLLTPSIMGLDAVYLFIKVLPVFLFGIQSVWVTNVYLNFILTLITMVLFALILF
                    ************************************************************

    COL             QGIFKIGHFSIYFILLIGVLLGTFFRSITGFIQLIMDPESFLAIQSSMFANFNASNSNLV
    N315            QGIFKIGHFSIYFILLIGVLLGTFFRSITGFIQLIMDPESFLAIQSSMFANFNASNSNLV
    NCTC8325        QGIFKIGHFSIYFILLIGVLLGTFFRSITGFIQLIMDPESFLAIQSSMFANFNASNSNLV
    Newman          QGIFKIGHFSIYFILLIGVLLGTFFRSITGFIQLIMDPESFLAIQSSMFANFNASNSNLV
    USA300_FPR3757  QGIFKIGHFSIYFILLIGVLLGTFFRSITGFIQLIMDPESFLAIQSSMFANFNASNSNLV
                    ************************************************************

    COL             TFSAVLLVILLVITILLLPYLDVLLLGRAEAINLGISYEKLTRILLVIVSVLVSVSTALV
    N315            TFSAVLLVILLVITILLLPYLDVLLLGRAEAINLGISYEKLTRILLVIVSVLVSVSTALV
    NCTC8325        TFSAVLLVILLVITILLLPYLDVLLLGRAEAINLGISYEKLTRILLVIVSVLVSVSTALV
    Newman          TFSAVLLVILLVITILLLPYLDVLLLGRAEAINLGISYEKLTRILLVIVSVLVSVSTALV
    USA300_FPR3757  TFSAVLLVILLVITILLLPYLDVLLLGRAEAINLGISYEKLTRILLVIVSVLVSVSTALV
                    ************************************************************

    COL             GPITFLGLLTVNLAHELMKTYEHKYILIATICLSWISLFSAQWVVENVFEATTEMSILID
    N315            GPITFLGLLTVNLAHELMKTYEHKYILIATICLSWISLFSAQWVVENVFEATTEMSILID
    NCTC8325        GPITFLGLLTVNLAHELMKTYEHKYILIATICLSWISLFSAQWVVESVFEATTEMSILID
    Newman          GPITFLGLLTVNLAHELMKTYEHKYILIATICLSWISLFSAQWVVENVFEATTEMSILID
    USA300_FPR3757  GPITFLGLLTVNLAHELMKTYEHKYILIATICLSWISLFSAQWVVENVFEATTEMSILID
                    **********************************************.*************

    COL             LIGGSYFIYLLVRRRNAQ
    N315            LIGGSYFIYLLVRRRNAQ
    NCTC8325        LIGGSYFIYLLVRRRNAQ
    Newman          LIGGSYFIYLLVRRRNAQ
    USA300_FPR3757  LIGGSYFIYLLVRRRNAQ
                    ******************