From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002640000
  • symbol?: sstD
  • description?: lipoprotein

      descriptions from strain specific annotations:

    • lipoprotein
    • periplasmic binding protein
    • transferrin receptor
    • Iron compound ABC uptake transporter substrate-binding protein
    • periplasmic binding family protein
    • ferrichrome ABC transporter lipoprotein
    • iron (Fe+3) ABC transporter binding protein
    • ABC-type siderophore binding protein
    • iron (Fe+3) ABC superfamily ATP binding cassette transporter, binding protein
    • ferric anguibactin-binding protein
  • strand?: +
  • coordinates?: 3140250..3141278
  • synteny block?: BlockID0018750
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0714
    08BA02176:
    C248_0823 (sstD)
    11819-97:
    MS7_0787
    71193:
    ST398NM01_0813
    ECT-R 2:
    ECTR2_687
    ED133:
    SAOV_0773
    ED98:
    SAAV_0698
    HO 5096 0412:
    SAEMRSA15_06620 (sstD)
    JH1:
    SaurJH1_0777
    JH9:
    SaurJH9_0760
    JKD6008:
    SAA6008_00751
    JKD6159:
    SAA6159_00692
    LGA251:
    SARLGA251_06690 (sstD)
    M013:
    M013TW_0722
    MRSA252:
    SAR0790 (sstD)
    MSHR1132:
    SAMSHR1132_06810
    MSSA476:
    SAS0701
    Mu3:
    SAHV_0733
    Mu50:
    SAV0736
    MW2:
    MW0698
    RF122:
    SAB0688 (sstD)
    ST398:
    SAPIG0813
    T0131:
    SAT0131_00808
    TCH60:
    HMPREF0772_12448 (sstD)
    TW20:
    SATW20_08110 (sstD)
    USA300_TCH1516:
    USA300HOU_0762
    VC40:
    SAVC_03315

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKTVLYLVLAVMFLLAACGNNSDKEQSKSETKGSKDTVKIENNYKMRGEKKDGSDAKKV
    N315            MKKTVLYLVLAVMFLLAACGNNSDKEQSKSETKGSKDTVKIENNYKMRGEKKDGSDAKKV
    NCTC8325        MKKTVLYLVLAVMFLLAACGNNSDKEQSKSETKGSKDTVKIENNYKMRGEKKDGSDAKKV
    Newman          MKKTVLYLVLAVMFLLAACGNNSDKEQSKSETKGSKDTVKIENNYKMRGEKKDGSDAKKV
    USA300_FPR3757  MKKTVLYLVLAVMFLLAACGNNSDKEQSKSETKGSKDTVKIENNYKMRGEKKDGSDAKKV
                    ************************************************************

    COL             KETVEVPKNPKNAVVLDYGALDVMKEMGLSDKVKALPKGEGGKSLPNFLESFKDDKYTNV
    N315            KETVEVPKNPKNAVVLDYGALDVMKEMGLSDKVKALPKGEGGKSLPNFLESFKDDKYTNV
    NCTC8325        KETVEVPKNPKNAVVLDYGALDVMKEMGLSDKVKALPKGEGGKSLPNFLESFKDDKYTNV
    Newman          KETVEVPKNPKNAVVLDYGALDVMKEMGLSDKVKALPKGEGGKSLPNFLESFKDDKYTNV
    USA300_FPR3757  KETVEVPKNPKNAVVLDYGALDVMKEMGLSDKVKALPKGEGGKSLPNFLESFKDDKYTNV
                    ************************************************************

    COL             GNLKEVNFDKIAATKPEVIFISGRTANQKNLDEFKKAAPKAKIVYVGADEKNLIGSMKQN
    N315            GNLKEVNFDKIAATKPEVIFISGRTANQKNLDEFKKAAPKAKIVYVGADEKNLIGSMKQN
    NCTC8325        GNLKEVNFDKIAATKPEVIFISGRTANQKNLDEFKKAAPKAKIVYVGADEKNLIGSMKQN
    Newman          GNLKEVNFDKIAATKPEVIFISGRTANQKNLDEFKKAAPKAKIVYVGADEKNLIGSMKQN
    USA300_FPR3757  GNLKEVNFDKIAATKPEVIFISGRTANQKNLDEFKKAAPKAKIVYVGADEKNLIGSMKQN
                    ************************************************************

    COL             TENIGKIYDKEDKAKELNKDLDNKIASMKDKTKNFNKTVMYLLVNEGELSTFGPKGRFGG
    N315            TENIGKIYDKEDKAKELNKDLDNKIASMKDKTKNFNKTVMYLLVNEGELSTFGPKGRFGG
    NCTC8325        TENIGKIYDKEDKAKELNKDLDNKIASMKDKTKNFNKTVMYLLVNEGELSTFGPKGRFGG
    Newman          TENIGKIYDKEDKAKELNKDLDNKIASMKDKTKNFNKTVMYLLVNEGELSTFGPKGRFGG
    USA300_FPR3757  TENIGKIYDKEDKAKELNKDLDNKIASMKDKTKNFNKTVMYLLVNEGELSTFGPKGRFGG
                    ************************************************************

    COL             LVYDTLGFNAVDKKVSNSNHGQNVSNEYVNKENPDVILAMDRGQAISGKSTAKQALNNPV
    N315            LVYDTLGFNAVDKKVSNSNHGQNVSNEYVNKENPDVILAMDRGQAISGKSTAKQALNNPV
    NCTC8325        LVYDTLGFNAVDKKVSNSNHGQNVSNEYVNKENPDVILAMDRGQAISGKSTAKQALNNPV
    Newman          LVYDTLGFNAVDKKVSNSNHGQNVSNEYVNKENPDVILAMDRGQAISGKSTAKQALNNPV
    USA300_FPR3757  LVYDTLGFNAVDKKVSNSNHGQNVSNEYVNKENPDVILAMDRGQAISGKSTAKQALNNPV
                    ************************************************************

    COL             LKNVKAIKEDKVYNLDPKLWYFAAGSTTTTIKQIEELDKVVK
    N315            LKNVKAIKEDKVYNLDPKLWYFAAGSTTTTIKQIEELDKVVK
    NCTC8325        LKNVKAIKEDKVYNLDPKLWYFAAGSTTTTIKQIEELDKVVK
    Newman          LKNVKAIKEDKVYNLDPKLWYFAAGSTTTTIKQIEELDKVVK
    USA300_FPR3757  LKNVKAIKEDKVYNLDPKLWYFAAGSTTTTIKQIEELDKVVK
                    ******************************************