From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002648000
  • symbol?:
  • description?: glycerate kinase

      descriptions from strain specific annotations:

    • glycerate kinase
    • glycerate kinase family protein
    • putative glycerate kinase
  • strand?: +
  • coordinates?: 3146847..3147948
  • synteny block?: BlockID0018830
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0720
    08BA02176:
    C248_0829
    11819-97:
    MS7_0792
    71193:
    ST398NM01_0818
    ECT-R 2:
    ECTR2_692
    ED133:
    SAOV_0779
    ED98:
    SAAV_0704
    HO 5096 0412:
    SAEMRSA15_06680
    JH1:
    SaurJH1_0783
    JH9:
    SaurJH9_0766
    JKD6008:
    SAA6008_00757
    JKD6159:
    SAA6159_00697
    LGA251:
    SARLGA251_06750
    M013:
    M013TW_0729
    MRSA252:
    SAR0796
    MSHR1132:
    SAMSHR1132_06870
    MSSA476:
    SAS0707
    Mu3:
    SAHV_0739
    Mu50:
    SAV0742
    MW2:
    MW0704
    RF122:
    SAB0694
    ST398:
    SAPIG0818
    T0131:
    SAT0131_00814
    TCH60:
    HMPREF0772_12441
    TW20:
    SATW20_08170
    USA300_TCH1516:
    USA300HOU_0769
    VC40:
    SAVC_03345

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKVLVAMDEFHGIISSYQANRYVEEAVASQIETADVVQVPLFNGRHELLDSVFLWQSGQK
    N315            MKVLVAMDEFHGIISSYQANRYVEEAVASQIETADVVQVPLFNGRHELLDSVFLWQSGQK
    NCTC8325        MKVLVAMDEFHGIISSYQANRYVEEAVASQIETADVVQVPLFNGRHELLDSVFLWQSGQK
    Newman          MKVLVAMDEFHGIISSYQANRYVEEAVASQIETADVVQVPLFNGRHELLDSVFLWQSGQK
    USA300_FPR3757  MKVLVAMDEFHGIISSYQANRYVEEAVASQIETADVVQVPLFNGRHELLDSVFLWQSGQK
                    ************************************************************

    COL             YRIPVHDADMNEVEGVYGQTDTGMTVIEGNLFLKGKKPIVERTSYGLGEMIKHALDNDAK
    N315            YRIPVHDADMNEVEGVYGQTDTGMTVIEGNLFLKGKKPIVERTSYGLGEMIKHALDNDAK
    NCTC8325        YRIPVHDADMNEVEGVYGQTDTGMTVIEGNLFLKGKKPIVERTSYGLGEMIKHALDNDAK
    Newman          YRIPVHDADMNEVEGVYGQTDTGMTVIEGNLFLKGKKPIVERTSYGLGEMIKHALDNDAK
    USA300_FPR3757  YRIPVHDADMNEVEGVYGQTDTGMTVIEGNLFLKGKKPIVERTSYGLGEMIKHALDNDAK
                    ************************************************************

    COL             HVVISLGGIDSFDAGAGMLQALGAQFYDDEGRVVDMRQGAGVIKYIRRMDMSNLHPKMET
    N315            HVVISLGGIDSFDAGAGMLQALGAQFYDDEGRVVDMRQGAGVIKYIRRMDMSNLHPKMET
    NCTC8325        HVVISLGGIDSFDAGAGMLQALGAQFYDDEGRVVDMRQGAGVIKYIRRMDMSNLHPKMET
    Newman          HVVISLGGIDSFDAGAGMLQALGAQFYDDEGRVVDMRQGAGVIKYIRRMDMSNLHPKMET
    USA300_FPR3757  HVVISLGGIDSFDAGAGMLQALGAQFYDDEGRVVDMRQGAGVIKYIRRMDMSNLHPKMET
                    ************************************************************

    COL             ARIQVMSDFSSRLYGKQSEIMQTYDAHQLNHNQAAEIDNLIWYFSELFKSELKIAIGPVE
    N315            ARIQVMSDFSSRLYGKQSEIMQTYDAHQLHHNQAAEIDNLIWYFSELFKSELKIAIGPVE
    NCTC8325        ARIQVMSDFSSRLYGKQSEIMQTYDAHQLNHNQAAEIDNLIWYFSELFKSELKIAIGPVE
    Newman          ARIQVMSDFSSRLYGKQSEIMQTYDAHQLNHNQAAEIDNLIWYFSELFKSELKIAIGPVE
    USA300_FPR3757  ARIQVMSDFSSRLYGKQSEIMQTYDAYQLNHNQAAEIDNLIWYFSELFKSELKIAIGPVE
                    **************************:**:******************************

    COL             RGGAGGGIAAVLNGLYQAEILTSHALVDQLTHLENLVEQADLIIFGEGLNENDQLLETTT
    N315            RGGAGGGIAAVLNGLYQAEILTSHALVDQLTHLENLVEQADLIIFGEGLNENDQLLETTT
    NCTC8325        RGGAGGGIAAVLNGLYQAEILTSHALVDQLTHLENLVEQADLIIFGEGLNENDQLLETTT
    Newman          RGGAGGGIAAVLNGLYQAEILTSHALVDQLTHLENLVEQADLIIFGEGLNENDQLLETTT
    USA300_FPR3757  RGGAGGGIAAVLNGLYQAEILTSHALVDQLTHLENLVEQADLIIFGEGLNENDQLLETTT
                    ************************************************************

    COL             LRIAELCHKHQKVAIAICATAEKFDLFESQGVTAMFNTFIDMPETYTDFKMGLQIRHYTV
    N315            LRIAELCHKHQKVAIAICATAEKFDLFESQGVTAMFNTFIDMPETYTDFKMGLQIRHYTV
    NCTC8325        LRIAELCHKHQKVAIAICATAEKFDLFESQGVTAMFNTFIDMPETYTDFKMGLQIRHYTV
    Newman          LRIAELCHKHQKVAIAICATAEKFDLFESQGVTAMFNTFIDMPETYTDFKMGLQIRHYTV
    USA300_FPR3757  LRIAELCHKHQKVAIAICATAEKFDLFESQGVTAMFNTFIDMPETYTDFKMGLQIRHYTV
                    ************************************************************

    COL             QSLKLLKTHFNVEV
    N315            QSLKLLKTHFNVEV
    NCTC8325        QSLKLLKTHFNVEV
    Newman          QSLKLLKTHFNVEV
    USA300_FPR3757  QSLKLLKTHFNVEV
                    **************