From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002652000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • Threonine/Serine Exporter
  • strand?: -
  • coordinates?: 3150035..3150796
  • synteny block?: BlockID0018870
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0723
    08BA02176:
    C248_0832
    11819-97:
    MS7_0795
    71193:
    ST398NM01_0821
    ECT-R 2:
    ECTR2_695
    ED133:
    SAOV_0782c
    ED98:
    SAAV_0707
    HO 5096 0412:
    SAEMRSA15_06710
    JH1:
    SaurJH1_0786
    JH9:
    SaurJH9_0769
    JKD6008:
    SAA6008_00760
    JKD6159:
    SAA6159_00700
    LGA251:
    SARLGA251_06780
    M013:
    M013TW_0732
    MRSA252:
    SAR0799
    MSHR1132:
    SAMSHR1132_06900
    MSSA476:
    SAS0710
    Mu3:
    SAHV_0742
    Mu50:
    SAV0745
    MW2:
    MW0707
    RF122:
    SAB0697c
    ST398:
    SAPIG0821
    T0131:
    SAT0131_00817
    TCH60:
    HMPREF0772_12438
    TW20:
    SATW20_08200
    USA300_TCH1516:
    USA300HOU_0772
    VC40:
    SAVC_03360

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MPDSITIIDENKVIDVVLIAGRILLESGAETYRVEDTMNRIAHSYGLHNTYSFVSSTAII
    N315            MPDSITIIDENKVIDVVLIAGRILLESGAETYRVEDTMNRIAHSYGLHNTYSFVSSTAII
    NCTC8325        MPDSITIIDENKVIDVVLIAGRILLESGAETYRVEDTMNRIAHSYGLHNTYSFVSSTAII
    Newman          MPDSITIIDENKVIDVVLIAGRILLESGAETYRVEDTMNRIAHSYGLHNTYSFVSSTAII
    USA300_FPR3757  MPDSITIIDENKVIDVVLIAGRILLESGAETYRVEDTMNRIAHSYGLHNTYSFVSSTAII
                    ************************************************************

    COL             FSLNDRTSTRLIRVQERTTDLEKIALTNSLSRKISNKELTIDEAKSEFIHLQHASLQYSF
    N315            FSLNDRTSTRLIRVQERTTDLEKIALTNSLSRKISNKELTIDEAKSEFIHLQHASLQYSF
    NCTC8325        FSLNDRTSTRLIRVQERTTDLEKIALTNSLSRKISNKELTIDEAKSEFIHLQHASLQYSF
    Newman          FSLNDRTSTRLIRVQERTTDLEKIALTNSLSRKISNKELTIDEAKSEFIHLQHASLQYSF
    USA300_FPR3757  FSLNDRTSTRLIRVQERTTDLEKIALTNSLSRKISNKELTIDEAKSEFIHLQHASLQYSF
                    ************************************************************

    COL             LTNFFAAAIACGFFLFMFGGVASDCWIAVIAGGSAFLTFSFVQRYIQIKFFSEFVAAAVV
    N315            LTNFFAAAIACGFFLFMFGGVASDCWIAVIAGGSAFLTFSFVQRYIQIKFFSEFVAAAVV
    NCTC8325        LTNFFAAAIACGFFLFMFGGVASDCWIAVIAGGSAFLTFSFVQRYIQIKFFSEFVAAAVV
    Newman          LTNFFAAAIACGFFLFMFGGVASDCWIAVIAGGSAFLTFSFVQRYIQIKFFSEFVAAAVV
    USA300_FPR3757  LTNFFAAAIACGFFLFMFGGVASDCWIAVIAGGSAFLTFSFVQRYIQIKFFSEFVAAAVV
                    ************************************************************

    COL             ISIAATFTKLGIATNQDIITIASVMPLVPGILITNAIRDLLAGELLAGMSRGVEAALTAF
    N315            ISIAATFTKLGIATNQDIITIASVMPLVPGILITNAIRDLLAGELLAGMSRGVEAALTAF
    NCTC8325        ISIAATFTKLGIATNQDIITIASVMPLVPGILITNAIRDLLAGELLAGMSRGVEAALTAF
    Newman          ISIAATFTKLGIATNQDIITIASVMPLVPGILITNAIRDLLAGELLAGMSRGVEAALTAF
    USA300_FPR3757  ISIAATFTKLGIATNQDIITIASVMPLVPGILITNAIRDLLAGELLAGMSRGVEAALTAF
                    ************************************************************

    COL             AIGAGVAIVLLII
    N315            AIGAGVAIVLLII
    NCTC8325        AIGAGVAIVLLII
    Newman          AIGAGVAIVLLII
    USA300_FPR3757  AIGAGVAIVLLII
                    *************