From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002653000
  • symbol?:
  • description?: GGDEF domain-containing protein

      descriptions from strain specific annotations:

    • GGDEF domain-containing protein
    • diguanylate cyclase
    • diguanylate cyclase domain protein
    • diguanylate cyclase GGDEF domain protein
    • ggdef domain protein
    • Sensory transduction protein kinase
  • strand?: -
  • coordinates?: 3150993..3152063
  • synteny block?: BlockID0018880
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0724
    08BA02176:
    C248_0833
    11819-97:
    MS7_0796
    71193:
    ST398NM01_0822
    ECT-R 2:
    ECTR2_696
    ED133:
    SAOV_0783c
    ED98:
    SAAV_0708
    HO 5096 0412:
    SAEMRSA15_06720
    JH1:
    SaurJH1_0787
    JH9:
    SaurJH9_0770
    JKD6008:
    SAA6008_00761
    JKD6159:
    SAA6159_00701
    LGA251:
    SARLGA251_06790
    M013:
    M013TW_0733
    MRSA252:
    SAR0800
    MSHR1132:
    SAMSHR1132_06910
    MSSA476:
    SAS0711
    Mu3:
    SAHV_0743
    Mu50:
    SAV0746
    MW2:
    MW0708
    RF122:
    SAB0698c
    ST398:
    SAPIG0822
    T0131:
    SAT0131_00818
    TCH60:
    HMPREF0772_12437
    TW20:
    SATW20_08210
    USA300_TCH1516:
    USA300HOU_0773
    VC40:
    SAVC_03365

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFEAFIYNISVIVAGIYLFHRLQYSENKRMVFSKAYVTVLMTIVSLLLSVYPIPYREDYL
    N315            MFEAFIYNISVIVAGIYLFHRLQYSENKRMVFSKAYVTVLMTIVSLLLSVYPIPYREDYL
    NCTC8325        MFEAFIYNISVIVAGIYLFHRLQYSENKRMVFSKAYVTVLMTIVSLLLSVYPIPYREDYL
    Newman          MFEAFIYNISVIVAGIYLFHRLQYSENKRMVFSKAYVTVLMTIVSLLLSVYPIPYREDYL
    USA300_FPR3757  MFEAFIYNISVIVAGIYLFHRLQYSENKRMVFSKAYVTVLMTIVSLLLSVYPIPYREDYL
                    ************************************************************

    COL             IHLTFVPLLFLGRFTNMVYTLSATVIVAIVEIVVFNNSIMYGVTLIVIAAVTSAIGPFLK
    N315            IHLTFVPLLFLGRFTNMVYTLSATVIVAIVEIVVFNNSIMYGVTLIVIAAVTSAIGPFLK
    NCTC8325        IHLTFVPLLFLGRFTNMVYTLSATVIVAIVEIVVFNNSIMYGVTLIVIAAVTSAIGPFLK
    Newman          IHLTFVPLLFLGRFTNMVYTLSATVIVAIVEIVVFNNSIMYGVTLIVIAAVTSAIGPFLK
    USA300_FPR3757  IHLTFVPLLFLGRFTNMVYTLSATVIVAIVEIVVFNNSIMYGVTLIVIAAVTSAIGPFLK
                    ************************************************************

    COL             QNDVLSLLILNVVTIIILFGVALVSPIYTLSEVIILIPISLIITLASAITFVDIWHFFSL
    N315            QNDVLSLLILNVVTIIILFGVALVSPIYTLSEVIILIPISLIITLASAITFVDIWHFFSL
    NCTC8325        QNDVLSLLILNVVTIIILFGVALVSPIYTLSEVIILIPISLIITLASAITFVDIWHFFSL
    Newman          QNDVLSLLILNVVTIIILFGVALVSPIYTLSEVIILIPISLIITLASAITFVDIWHFFSL
    USA300_FPR3757  QNDVLSLLILNVVTIIILFGVALVSPIYTLSEVIILIPISLIITLASAITFVDIWHFFSL
                    ************************************************************

    COL             VNRYENEDKYDYLTGLGNVKEFDRHLNEISRKAEKEHQSIALLLIDIDGFKDVNDTYSHK
    N315            VNRYENEDKYDYLTGLGNVKEFDRHLNEISRKAEKEHQSIALLLIDIDGFKDVNDTYSHK
    NCTC8325        VNRYENEDKYDYLTGLGNVKEFDRHLNEISRKAEKEHQSIALLLIDIDGFKDVNDTYSHK
    Newman          VNRYENEDKYDYLTGLGNVKEFDRHLNEISRKAEKEHQSIALLLIDIDGFKDVNDTYSHK
    USA300_FPR3757  VNRYENEDKYDYLTGLGNVKEFDRHLNEISRKAEKEHQSIALLLIDIDGFKDVNDTYSHK
                    ************************************************************

    COL             SGDAVLKQMSQLLKNYVPNQFKIFRNGGEEFSVVIHNYSLDQSVKLAENIRSGVEKSSFH
    N315            SGDAVLKQMSQLLKNYVPNQFKIFRNGGEEFSVVIHNYSLDQSVKLAENIRSGVEKSSFH
    NCTC8325        SGDAVLKQMSQLLKNYVPNQFKIFRNGGEEFSVVIHNYSLDQSVKLAENIRSGVEKSSFH
    Newman          SGDAVLKQMSQLLKNYVPNQFKIFRNGGEEFSVVIHNYSLDQSVKLAENIRSGVEKSSFH
    USA300_FPR3757  SGDAVLKQMSQLLKNYVPNQFKIFRNGGEEFSVVIHNYSLDQSVKLAENIRSGVEKSSFH
                    ************************************************************

    COL             LPNKEVIKLSVSIGVGYLTDDDPKSQRKVFKDADDMVHVAKNQGRNKVMFNPIINL
    N315            LPNKEVIKLSVSIGVGYLTDDDPKSQRKVFKDADDMVHVAKNQGRNKVMFNPIINL
    NCTC8325        LPNKEVIKLSVSIGVGYLTDDDPKSQRKVFKDADDMVHVAKNQGRNKVMFNPIINL
    Newman          LPNKEVIKLSVSIGVGYLTDDDPKSQRKVFKDADDMVHVAKNQGRNKVMFNPIINL
    USA300_FPR3757  LPNKEVIKLSVSIGVGYLTDDDPKSQRKVFKDADDMVHVAKNQGRNKVMFNPIINL
                    ********************************************************