From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002657000
  • symbol?:
  • description?: degV family protein

      descriptions from strain specific annotations:

    • degV family protein
    • Conserved hypothetical DegV family protein
    • DegV domain-containing protein
    • EDD, DegV family domain protein
  • strand?: +
  • coordinates?: 3154482..3155588
  • synteny block?: BlockID0018920
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0727
    08BA02176:
    C248_0836
    11819-97:
    MS7_0799
    71193:
    ST398NM01_0825
    ECT-R 2:
    ECTR2_699
    ED133:
    SAOV_0786
    ED98:
    SAAV_0711
    HO 5096 0412:
    SAEMRSA15_06750
    JH1:
    SaurJH1_0790
    JH9:
    SaurJH9_0773
    JKD6008:
    SAA6008_00764
    JKD6159:
    SAA6159_00704
    LGA251:
    SARLGA251_06820
    M013:
    M013TW_0736
    MRSA252:
    SAR0803
    MSHR1132:
    SAMSHR1132_06940
    MSSA476:
    SAS0714
    Mu3:
    SAHV_0746
    Mu50:
    SAV0749
    MW2:
    MW0711
    RF122:
    SAB0701
    ST398:
    SAPIG0825
    T0131:
    SAT0131_00821
    TCH60:
    HMPREF0772_12433
    TW20:
    SATW20_08240
    USA300_TCH1516:
    USA300HOU_0776
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIAVMTDSTSYLSQDLIDKYNIQIAPLSVTFDDGKNFTESNEIAIEEFYNKMASSQTIP
    N315            MKIAVMTDSTSYLSQDLIDKYNIQIAPLSVTFDDGKNFTESNEIAIEEFYNKMASSQTIP
    Newman          MKIAVMTDSTSYLSQDLIDKYNIQIAPLSVTFDDGKNFTESNEIAIEEFYNKMASSQTIP
    USA300_FPR3757  MKIAVMTDSTSYLSQDLIDKYNIQIAPLSVTFDDGKNFTESNEIAIEEFYNKMASSQTIP
                    ************************************************************

    COL             TTSQPAIGEWITKYEMLRDQGYTDIIVICLSSGISGSYQSSYQAGEMVEGVNVHAFDSKL
    N315            TTSQPAIGEWITKYEMLRDQGYTDIIVICLSSGISGSYQSSYQAGEMVEGVNVHAFDSKL
    Newman          TTSQPAIGEWITKYEMLRDQGYTDIIVICLSSGISGSYQSSYQAGEMVEGVNVHAFDSKL
    USA300_FPR3757  TTSQPAIGEWITKYEMLRDQGYTDIIVICLSSGISGSYQSSYQAGEMVEGVNVHAFDSKL
                    ************************************************************

    COL             AAMIEGCYVLRAIEMVEEGYEPQQIIDDLTNMREHTGAYLIVDDLKNLQKSGRITGAQAW
    N315            AAMIEGCYVLRAIEMVEEGYEPQQIIDDLTNMREHTGAYLIVDDLKNLQKSGRITGAQAW
    Newman          AAMIEGCYVLRAIEMVEEGYEPQQIIDDLTNMREHTGAYLIVDDLKNLQKSGRITGAQAW
    USA300_FPR3757  AAMIEGCYVLRAIEMVEEGYEPQQIIDDLTNMREHTGAYLIVDDLKNLQKSGRITGAQAW
                    ************************************************************

    COL             VGTLLKMKPVLKFEDGKIIPEEKVRTKKRAIQTLEKKVLDIVKDFEEVTLFVINGDHFED
    N315            VGTLLKMKPVLKFEDGKIIPEEKVRTKKRAIQTLEKKVLDIVKDFEEVTLFVINGDHFED
    Newman          VGTLLKMKPVLKFEDGKIIPEEKVRTKKRAIQTLEKKVLDIVKDFEEVTLFVINGDHFED
    USA300_FPR3757  VGTLLKMKPVLKFEDGKIIPEEKVRTKKRAIQTLEKKVLDIVKDFEEVTLFVINGDHFED
                    ************************************************************

    COL             GQALYKKLQDDCPSAYQVAYSEFGPVVAAHLGSGGLGLGYVGRKIRLT
    N315            GQALYKKLQEDCPSGYQVAYSEFGPVVAAHLGSGGLGLGYVGRKIRLT
    Newman          GQALYKKLQDDCPSAYQVAYSEFGPVVAAHLGSGGLGLGYVGRKIRLT
    USA300_FPR3757  GQALYKKLQDDCPSAYQVAYSEFGPVVAAHLGSGGLGLGYVGRKIRLT
                    *********:****.*********************************