From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002670000
  • symbol?:
  • description?: hydrolase

      descriptions from strain specific annotations:

    • hydrolase
    • HD domain-containing protein
    • metal dependent phosphohydrolase
    • HAD family phosphatase
    • HD containing hydrolase-like enzyme
    • HD domain protein
    • HD superfamily hydrolase
    • Nucleotidase YfbR, HD superfamily
    • putative HD-family metal-dependent phosphohydrolase
    • putative phosphohydrolase
  • strand?: +
  • coordinates?: 3166287..3166955
  • synteny block?: BlockID0019050
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0734 (yfbR)
    08BA02176:
    C248_0843
    11819-97:
    MS7_0806
    71193:
    ST398NM01_0832
    ECT-R 2:
    ECTR2_706
    ED133:
    SAOV_0793
    ED98:
    SAAV_0719
    HO 5096 0412:
    SAEMRSA15_06820
    JH1:
    SaurJH1_0797
    JH9:
    SaurJH9_0780
    JKD6008:
    SAA6008_00771
    JKD6159:
    SAA6159_00711
    LGA251:
    SARLGA251_06890
    M013:
    M013TW_0743
    MRSA252:
    SAR0810
    MSHR1132:
    SAMSHR1132_07010
    MSSA476:
    SAS0721
    Mu3:
    SAHV_0753
    Mu50:
    SAV0756
    MW2:
    MW0718
    RF122:
    SAB0709
    ST398:
    SAPIG0832
    T0131:
    SAT0131_00828
    TCH60:
    HMPREF0772_12425
    TW20:
    SATW20_08310
    USA300_TCH1516:
    USA300HOU_0784
    VC40:
    SAVC_03415

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGVHQYFKRLSDMERLIRLPGKFKYFEHNVAAHSFKVTKIAQYLATVEEYHGRKINWKSL
    N315            MGVHQYFKRLSDMERLIRLPGKFKYFEHNVAAHSFKVTKIAQYLATVEEYHGRKINWKSL
    NCTC8325        MGVHQYFKRLSDMERLIRLPGKFKYFEHNVAAHSFKVTKIAQYLATVEEYHGRKINWKSL
    Newman          MGVHQYFKRLSDMERLIRLPGKFKYFEHNVAAHSFKVTKIAQYLATVEEYHGRKINWKSL
    USA300_FPR3757  MGVHQYFKRLSDMERLIRLPGKFKYFEHNVAAHSFKVTKIAQYLATVEEYHGRKINWKSL
                    ************************************************************

    COL             YEKALNHDFAEVFTGDIKTPVKYASSELKKLFSQVEEEMVETFIEEEIPLQYRDVYKQRL
    N315            YEKALNHDFAEVFTGDIKTPVKYASSELKKLFSQVEEEMVETFIEEEIPLQYRDVYKQRL
    NCTC8325        YEKALNHDFAEVFTGDIKTPVKYASSELKKLFSQVEEEMVETFIEEEIPLQYRDVYKQRL
    Newman          YEKALNHDFAEVFTGDIKTPVKYASSELKKLFSQVEEEMVETFIEEEIPLQYRDVYKQRL
    USA300_FPR3757  YEKALNHDFAEVFTGDIKTPVKYASSELKKLFSQVEEEMVETFIEEEIPLQYRDVYKQRL
                    ************************************************************

    COL             QEGKDDSLEGQILSVADKIDLLYETFGEIQKRNPEELFFEIYEMSLETIIQFDHLASVQD
    N315            QEGKDDSLEGQILSVADKIDLLYETFGEIQKRNPEELFFEIYEMSLETIIQFDHLASVQD
    NCTC8325        QEGKDDSLEGQILSVADKIDLLYETFGEIQKRNPEELFFEIYEMSLETIIQFDHLASVQD
    Newman          QEGKDDSLEGQILSVADKIDLLYETFGEIQKRNPEELFFEIYEMSLETIIQFDHLASVQD
    USA300_FPR3757  QEGKDDSLEGQILSVADKIDLLYETFGEIQKRNPEELFFEIYEMSLETIIQFDHLASVQD
                    ************************************************************

    COL             FINNIIPEMLTENFIPRTELRETTMNILNKRKEENE
    N315            FINNIIPEMLTENFIPRTELRETTMNILNKRKEENE
    NCTC8325        FINNIIPEMLTENFIPRTELRETTMNILNKRKEENE
    Newman          FINNIIPEMLTENFIPRTELRETTMNILNKRKEENE
    USA300_FPR3757  FINNIIPEMLTENFIPRTELRETTMNILNKRKEENE
                    ************************************