From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002671000
  • symbol?: csbA
  • description?: Csba

      descriptions from strain specific annotations:

    • Csba
    • protein csbA
  • strand?: +
  • coordinates?: 3166952..3167188
  • synteny block?: BlockID0019060
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0735
    08BA02176:
    C248_0844
    11819-97:
    MS7_0807
    71193:
    ST398NM01_0833
    ECT-R 2:
    ECTR2_707
    ED133:
    SAOV_0794
    ED98:
    SAAV_0720
    HO 5096 0412:
    SAEMRSA15_06830
    JH1:
    SaurJH1_0798
    JH9:
    SaurJH9_0781
    JKD6008:
    SAA6008_00772
    JKD6159:
    SAA6159_00712
    LGA251:
    SARLGA251_06900
    M013:
    M013TW_0744
    MRSA252:
    SAR0811
    MSHR1132:
    SAMSHR1132_07020
    MSSA476:
    SAS0722
    Mu3:
    SAHV_0754
    Mu50:
    SAV0757
    MW2:
    MW0719
    RF122:
    SAB0710
    ST398:
    SAPIG0833
    T0131:
    SAT0131_00829
    TCH60:
    HMPREF0772_12424
    TW20:
    SATW20_08320
    USA300_TCH1516:
    USA300HOU_0785
    VC40:
    SAVC_03420

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIWYFSAAFFPCVLVVLFSVITRSKWVGTILTLILIGASIYKEYFHNEWIIFIDVVSLLA
    N315            MIWYFSAAFFPCVLVVLFSVITRSKWVGTILTLILIGASIYKEYFHNEWIIFIDVVSLLA
    NCTC8325        MIWYFSAAFFPCVLVVLFSVITRSKWVGTILTLILIGASIYKEYFHNEWIIFIDVVSLLA
                    ************************************************************

    COL             GYLIIDQLEFHKHQDEDR
    N315            GYLIIDQLEFHKHQDEDR
    NCTC8325        GYLIIDQLEFHKHQDEDR
                    ******************