From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002679000
  • symbol?: hprK
  • description?: HPr kinase/phosphorylase

      descriptions from strain specific annotations:

    • HPr kinase/phosphorylase
    • Hpr(Ser) kinase
    • HPr(Ser) kinase/phosphatase
    • HPr(Ser) kinase phosphatase
    • HPr kinase/phosphatase
  • strand?: +
  • coordinates?: 3177782..3178571
  • synteny block?: BlockID0019110
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0825 (hprK)
    N315:
    SA0715 (hprK)
    NCTC8325:
    Newman:
    NWMN_0728 (hprK)
    USA300_FPR3757:
    04-02981:
    SA2981_0738 (hprK)
    08BA02176:
    C248_0847 (hprK)
    11819-97:
    MS7_0810 (hprK)
    71193:
    ST398NM01_0836
    ECT-R 2:
    ECTR2_710 (hprK)
    ED133:
    SAOV_0797
    ED98:
    SAAV_0723 (hprK)
    HO 5096 0412:
    SAEMRSA15_06860 (hprK)
    JH1:
    SaurJH1_0801
    JH9:
    SaurJH9_0784
    JKD6008:
    SAA6008_00775 (hprK)
    JKD6159:
    SAA6159_00717 (hprK)
    LGA251:
    SARLGA251_06930 (hprK)
    M013:
    M013TW_0747
    MRSA252:
    SAR0814 (hprK)
    MSHR1132:
    SAMSHR1132_07050
    MSSA476:
    SAS0725
    Mu3:
    SAHV_0757 (hprK)
    Mu50:
    SAV0760 (hprK)
    MW2:
    MW0722 (hprK)
    RF122:
    SAB0713 (hprK)
    ST398:
    SAPIG0836 (hprK)
    T0131:
    SAT0131_00832
    TCH60:
    HMPREF0772_12421 (hprK)
    TW20:
    SATW20_08350 (hprK)
    USA300_TCH1516:
    USA300HOU_0788 (hprK)
    VC40:
    SAVC_03435

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLTTEKLVETLKLDLIAGEEGLSKPIKNADISRPGLEMAGYFSHYASDRIQLLGTTELSF
    N315            MLTTEKLVETLKLDLIAGEEGLSKPIKNADISRPGLEMAGYFSHYASDRIQLLGTTELSF
    NCTC8325        MLTTEKLVETLKLDLIAGEEGLSKPIKNADISRPGLEMAGYFSHYASDRIQLLGTTELSF
    Newman          MLTTEKLVETLKLDLIAGEEGLSKPIKNADISRPGLEMAGYFSHYASDRIQLLGTTELSF
    USA300_FPR3757  MLTTEKLVETLKLDLIAGEEGLSKPIKNADISRPGLEMAGYFSHYASDRIQLLGTTELSF
                    ************************************************************

    COL             YNLLPDKDRAGRMRKLCRPETPAIIVTRGLQPPEELVEAAKELNTPLIVAKDATTSLMSR
    N315            YNLLPDKDRAGRMRKLCRPETPAIIVTRGLQPPEELVEAAKELNTPLIVAKDATTSLMSR
    NCTC8325        YNLLPDKDRAGRMRKLCRPETPAIIVTRGLQPPEELVEAAKELNTPLIVAKDATTSLMSR
    Newman          YNLLPDKDRAGRMRKLCRPETPAIIVTRGLQPPEELVEAAKELNTPLIVAKDATTSLMSR
    USA300_FPR3757  YNLLPDKDRAGRMRKLCRPETPAIIVTRGLQPPEELVEAAKELNTPLIVAKDATTSLMSR
                    ************************************************************

    COL             LTTFLEHALAKTTSLHGVLVDVYGVGVLITGDSGIGKSETALELVKRGHRLVADDNVEIR
    N315            LTTFLEHALAKTTSLHGVLVDVYGVGVLITGDSGIGKSETALELVKRGHRLVADDNVEIR
    NCTC8325        LTTFLEHALAKTTSLHGVLVDVYGVGVLITGDSGIGKSETALELVKRGHRLVADDNVEIR
    Newman          LTTFLEHALAKTTSLHGVLVDVYGVGVLITGDSGIGKSETALELVKRGHRLVADDNVEIR
    USA300_FPR3757  LTTFLEHALAKTTSLHGVLVDVYGVGVLITGDSGIGKSETALELVKRGHRLVADDNVEIR
                    ************************************************************

    COL             QINKDELIGKPPKLIEHLLEIRGLGIINVMTLFGAGSILTEKRIRLNINLENWNKQKLYD
    N315            QINKDELIGKPPKLIEHLLEIRGLGIINVMTLFGAGSILTEKRIRLNINLENWNKQKLYD
    NCTC8325        QINKDELIGKPPKLIEHLLEIRGLGIINVMTLFGAGSILTEKRIRLNINLENWNKQKLYD
    Newman          QINKDELIGKPPKLIEHLLEIRGLGIINVMTLFGAGSILTEKRIRLNINLENWNKQKLYD
    USA300_FPR3757  QINKDELIGKPPKLIEHLLEIRGLGIINVMTLFGAGSILTEKRIRLNINLENWNKQKLYD
                    ************************************************************

    COL             RVGLNEETLSILDTEITKKTIPVRPGRNVAVIIEVAAMNYRLNIMGINTAEEFSERLNEE
    N315            RVGLNEETLSILDTEITKKTIPVRPGRNVAVIIEVAAMNYRLNIMGINTAEEFSERLNEE
    NCTC8325        RVGLNEETLSILDTEITKKTIPVRPGRNVAVIIEVAAMNYRLNIMGINTAEEFSERLNEE
    Newman          RVGLNEETLSILDTEITKKTIPVRPGRNVAVIIEVAAMNYRLNIMGINTAEEFSERLNEE
    USA300_FPR3757  RVGLNEETLSILDTEITKKTIPVRPGRNVAVIIEVAAMNYRLNIMGINTAEEFSERLNEE
                    ************************************************************

    COL             IIKNSHKSEE
    N315            IIKNSHKSEE
    NCTC8325        IIKNSHKSEE
    Newman          IIKNSHKSEE
    USA300_FPR3757  IIKNSHKSEE
                    **********