Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002690000
  • symbol?:
  • description?: Transporter

      descriptions from strain specific annotations:

    • Transporter
    • protein YvcK
    • membrane associated protein
  • strand?: +
  • coordinates?: 3184695..3185690
  • synteny block?: BlockID0019220
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0744
    08BA02176:
    C248_0854
    11819-97:
    MS7_0816
    71193:
    ST398NM01_0843
    ECT-R 2:
    ECTR2_716
    ED133:
    SAOV_0804
    ED98:
    SAAV_0730
    HO 5096 0412:
    SAEMRSA15_06920
    JH1:
    SaurJH1_0807
    JH9:
    SaurJH9_0791
    JKD6008:
    SAA6008_00781
    JKD6159:
    SAA6159_00723
    LGA251:
    SARLGA251_06990
    M013:
    M013TW_0753
    MRSA252:
    SAR0821
    MSHR1132:
    SAMSHR1132_07110
    MSSA476:
    SAS0731
    Mu3:
    SAHV_0763
    Mu50:
    SAV0766
    MW2:
    MW0728
    RF122:
    SAB0720
    ST398:
    SAPIG0843
    T0131:
    SAT0131_00838
    TCH60:
    HMPREF0772_12414
    TW20:
    SATW20_08410
    USA300_TCH1516:
    USA300HOU_0795
    VC40:
    SAVC_03475

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRQIKVVLIGGGTGLSVMARGLREFPIDITAIVTVADNGGSTGKIRDEMDIPAPGDIRNV
    N315            MRQIKVVLIGGGTGLSVMARGLREFPIDITAIVTVADNGGSTGKIRDEMDIPAPGDIRNV
    NCTC8325        MRQIKVVLIGGGTGLSVMARGLREFPIDITAIVTVADNGGSTGKIRDEMDIPAPGDIRNV
    Newman          MRQIKVVLIGGGTGLSVMARGLREFPIDITAIVTVADNGGSTGKIRDEMDIPAPGDIRNV
    USA300_FPR3757  MRQIKVVLIGGGTGLSVMARGLREFPIDITAIVTVADNGGSTGKIRDEMDIPAPGDIRNV
                    ************************************************************

    COL             IAALSDSESVLSQLFQYRFEENQISGHSLGNLLIAGMTNITNDFGHAIKALSKILNIKGR
    N315            IAALSDSESVLSQLFQYRFEENQISGHSLGNLLIAGMTNITNDFGHAIKALSKILNIKGR
    NCTC8325        IAALSDSESVLSQLFQYRFEENQISGHSLGNLLIAGMTNITNDFGHAIKALSKILNIKGR
    Newman          IAALSDSESVLSQLFQYRFEENQISGHSLGNLLIAGMTNITNDFGHAIKALSKILNIKGR
    USA300_FPR3757  IAALSDSESVLSQLFQYRFEENQISGHSLGNLLIAGMTNITNDFGHAIKALSKILNIKGR
                    ************************************************************

    COL             VIPSTNTSVQLNAVMEDGEIVFGETNIPKKHKKIDRVFLEPNDVQPMEEAIDALREADLI
    N315            VIPSTNTSVQLNAVMEDGEIVFGETNIPKKHKKIDRVFLEPNDVQPMEEAIDALREADLI
    NCTC8325        VIPSTNTSVQLNAVMEDGEIVFGETNIPKKHKKIDRVFLEPNDVQPMEEAIDALREADLI
    Newman          VIPSTNTSVQLNAVMEDGEIVFGETNIPKKHKKIDRVFLEPNDVQPMEEAIDALREADLI
    USA300_FPR3757  VIPSTNTSVQLNAVMEDGEIVFGETNIPKKHKKIDRVFLEPNDVQPMEEAIDALREADLI
                    ************************************************************

    COL             VLGPGSLYTSVISNLCVNGISDALIHSDAPKLYVSNVMTQPGETDGYSVKDHIDAIHRQA
    N315            VLGPGSLYTSVISNLCVNGISDALIHSDAPKLYVSNVMTQPGETDGYSVKDHIDAIHRQA
    NCTC8325        VLGPGSLYTSVISNLCVNGISDALIHSDAPKLYVSNVMTQPGETDGYSVKDHIDAIHRQA
    Newman          VLGPGSLYTSVISNLCVNGISDALIHSDAPKLYVSNVMTQPGETDGYSVKDHIDAIHRQA
    USA300_FPR3757  VLGPGSLYTSVISNLCVNGISDALIHSDAPKLYVSNVMTQPGETDGYSVKDHIDAIHRQA
                    ************************************************************

    COL             GQPFIDYVICSTQTFNAQVLKKYEEKHSKPVEVNKAELEKESINVKTSSNLVEISENHLV
    N315            GQPFIDYVICSTQTFNAQVLKKYEEKHSKPVEVNKAELEKESINVKTSSNLVEISENHLV
    NCTC8325        GQPFIDYVICSTQTFNAQVLKKYEEKHSKPVEVNKAELEKESINVKTSSNLVEISENHLV
    Newman          GQPFIDYVICSTQTFNAQVLKKYEEKHSKPVEVNKAELEKESINVKTSSNLVEISENHLV
    USA300_FPR3757  GQPFIDYVICSTQTFNAQVLKKYEEKHSKPVEVNKAELEKESINVKTSSNLVEISENHLV
                    ************************************************************

    COL             RHNTKVLSTMIYDIALELISTIPFVPSDKRK
    N315            RHNTKVLSTMIYDIALELISTIPFVPSDKRK
    NCTC8325        RHNTKVLSTMIYDIALELISTIPFVPSDKRK
    Newman          RHNTKVLSTMIYDIALELISTIPFVPSDKRK
    USA300_FPR3757  RHNTKVLSTMIYDIALELISTIPFVPSDKRK
                    *******************************