From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002695000
  • symbol?: clpP
  • description?: ATP-dependent Clp protease proteolytic subunit

      descriptions from strain specific annotations:

    • ATP-dependent Clp protease proteolytic subunit
    • ATP-dependent Clp protease, proteolytic subunit ClpP
    • putative ATP-dependent Clp protease proteolyticsubunit
    • ATP-dependent endopeptidase clp proteolytic subunit
  • strand?: +
  • coordinates?: 3187331..3187918
  • synteny block?: BlockID0019270
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0833 (clpP)
    N315:
    SA0723 (clpP)
    NCTC8325:
    Newman:
    NWMN_0736 (clpP)
    USA300_FPR3757:
    04-02981:
    SA2981_0746 (clpP)
    08BA02176:
    C248_0857 (clpP)
    11819-97:
    MS7_0819 (clpP)
    71193:
    ST398NM01_0846
    ECT-R 2:
    ECTR2_719 (clpP)
    ED133:
    SAOV_0807
    ED98:
    SAAV_0733 (clpP)
    HO 5096 0412:
    SAEMRSA15_06940 (clpP)
    JH1:
    SaurJH1_0809 (clpP)
    JH9:
    SaurJH9_0793 (clpP)
    JKD6008:
    SAA6008_00783 (clpP)
    JKD6159:
    SAA6159_00725 (clpP)
    LGA251:
    SARLGA251_07010 (clpP)
    M013:
    M013TW_0758
    MRSA252:
    SAR0823 (clpP)
    MSHR1132:
    SAMSHR1132_07130
    MSSA476:
    SAS0733 (clpP)
    Mu3:
    SAHV_0765 (clpP)
    Mu50:
    SAV0768 (clpP)
    MW2:
    MW0730 (clpP)
    RF122:
    SAB0722 (clpP)
    ST398:
    SAPIG0846 (clpP)
    T0131:
    SAT0131_00840
    TCH60:
    HMPREF0772_12412 (clpP)
    TW20:
    SATW20_08430 (clpP)
    USA300_TCH1516:
    USA300HOU_0797 (clpP)
    VC40:
    SAVC_03485 (clpP)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNLIPTVIETTNRGERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDI
    N315            MNLIPTVIETTNRGERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDI
    NCTC8325        MNLIPTVIETTNRGERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDI
    Newman          MNLIPTVIETTNRGERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDI
    USA300_FPR3757  MNLIPTVIETTNRGERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDI
                    ************************************************************

    COL             YLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEV
    N315            YLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEV
    NCTC8325        YLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEV
    Newman          YLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEV
    USA300_FPR3757  YLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEV
                    ************************************************************

    COL             MIHQPLGGAQGQATEIEIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEA
    N315            MIHQPLGGAQGQATEIEIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEA
    NCTC8325        MIHQPLGGAQGQATEIEIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEA
    Newman          MIHQPLGGAQGQATEIEIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEA
    USA300_FPR3757  MIHQPLGGAQGQATEIEIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEA
                    ************************************************************

    COL             KEYGLIDEVMVPETK
    N315            KEYGLIDEVMVPETK
    NCTC8325        KEYGLIDEVMVPETK
    Newman          KEYGLIDEVMVPETK
    USA300_FPR3757  KEYGLIDEVMVPETK
                    ***************