From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002697000
  • symbol?:
  • description?: Cell division inhibitor

      descriptions from strain specific annotations:

    • Cell division inhibitor
    • NAD dependent epimerase/dehydratase family protein
    • Epimerase family protein
    • putative Cell division inhibitor
  • strand?: -
  • coordinates?: 3190262..3191131
  • synteny block?: BlockID0019290
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0747
    08BA02176:
    C248_0859
    11819-97:
    MS7_0820
    71193:
    ST398NM01_0848
    ECT-R 2:
    ECTR2_720
    ED133:
    SAOV_0809c
    ED98:
    SAAV_0734
    HO 5096 0412:
    SAEMRSA15_06960
    JH1:
    SaurJH1_0810
    JH9:
    SaurJH9_0794
    JKD6008:
    SAA6008_00784
    JKD6159:
    SAA6159_00726
    LGA251:
    SARLGA251_07030
    M013:
    M013TW_0760
    MRSA252:
    SAR0825
    MSHR1132:
    SAMSHR1132_07150
    MSSA476:
    SAS0734
    Mu3:
    SAHV_0766
    Mu50:
    SAV0769
    MW2:
    MW0731
    RF122:
    SAB0724c
    ST398:
    SAPIG0848
    T0131:
    SAT0131_00841
    TCH60:
    HMPREF0772_12410
    TW20:
    SATW20_08440
    USA300_TCH1516:
    USA300HOU_0798
    VC40:
    SAVC_03490

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKQYLITGGTGMVGSQLVNEIKKSDSHITILTRHDQISNDKKISYVNWAKSGWEHKVPQN
    N315            MKQYLITGGTGMVGSQLVNEIKKSDSHITILTRHDQISNDKKISYVNWAKSGWEHKVPQN
    NCTC8325        MKQYLITGGTGMVGSQLVNEIKKSDSHITILTRHDQISNDKKISYVNWAKSGWEHKVPQN
    Newman          MKQYLITGGTGMVGSQLVNEIKKSDSHITILTRHDQISNDKKISYVNWAKSGWEHKVPQN
    USA300_FPR3757  MKQYLITGGTGMVGSQLVNEIKKSDSHITILTRHDQISNDKKISYVNWAKSGWEHKVPQN
                    ************************************************************

    COL             IDVVINLAGATLNKRWTPEYKQTLMLSRIQSTQALYELFKSRNKAPKALFNASATGYYPP
    N315            IDVVINLAGATLNKRWTPEYKQTLMLSRIQSTQALYELFKSRNKAPKVLFNASATGYYPP
    NCTC8325        IDVVINLAGATLNKRWTPEYKQTLMLSRIQSTQALYELFKSRNKAPKALFNASATGYYPP
    Newman          IDVVINLAGATLNKRWTPEYKQTLMLSRIQSTQALYELFKSRNKAPKALFNASATGYYPP
    USA300_FPR3757  IDVVINLAGATLNKRWTPEYKQTLMLSRIQSTQALYELFKSRNKAPKALFNASATGYYPP
                    ***********************************************.************

    COL             DLFMSYTEVYKTLPFDFLSDIVYQWERFAQQFEQLGTRVVIGRFGIILSNEGGALQTMKL
    N315            DLFMSYTEVYKTLPFDFLSDIVYQWERFAQQFEQLGTRVVIGRFGMILSNEGGALQTMKL
    NCTC8325        DLFMSYTEVYKTLPFDFLSDIVYQWERFAQQFEQLGTRVVIGRFGIILSNEGGALQTMKL
    Newman          DLFMSYTEVYKTLPFDFLSDIVYQWERFAQQFEQLGTRVVIGRFGIILSNEGGALQTMKL
    USA300_FPR3757  DLFMSYTEVYKTLPFDFLSDIVYQWERFAQQFEQLGTRVVIGRFGIILSNEGGALQTMKL
                    *********************************************:**************

    COL             PYEYYIGGKLGSGQQWYSWIHINDLIQAILFLINNESASGPFNLTAPIPERQNLFGYTLA
    N315            PYKYYIGGKLGSGQQWYSWIHINDLIQAILFLINNESASGPFNLTAPIPERQNLFGYTLA
    NCTC8325        PYEYYIGGKLGSGQQWYSWIHINDLIQAILFLINNESASGPFNLTAPIPERQNLFGYTLA
    Newman          PYEYYIGGKLGSGQQWYSWIHINDLIQAILFLINNESASGPFNLTAPIPERQNLFGYTLA
    USA300_FPR3757  PYEYYIGGKLGSGQQWYSWIHINDLIQAILFLINNESASGPFNLTAPIPERQNLFGYTLA
                    **:*********************************************************

    COL             RAMHKPHETWAPSLAMRLILGQMSTVVLDTQKVLPNKIQALGFQFKYSNLKMALEDLIKE
    N315            RAMHKPHETWAPSLAMRLILGQMSTVVLDTQKVLPNKIQALGFQFKYSNLKMALEDLIKE
    NCTC8325        RAMHKPHETWAPSLAMRLILGQMSTVVLDTQKVLPNKIQALGFQFKYSNLKMALEDLIKE
    Newman          RAMHKPHETWAPSLAMRLILGQMSTVVLDTQKVLPNKIQALGFQFKYSNLKMALEDLIKE
    USA300_FPR3757  RAMHKPHETWAPSLAMRLILGQMSTVVLDTQKVLPNKIQALGFQFKYSNLKMALEDLIKE
                    ************************************************************