From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002707000
  • symbol?: pgk
  • description?: phosphoglycerate kinase
  • strand?: +
  • coordinates?: 3196032..3197222
  • synteny block?: BlockID0019390
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0839 (pgk)
    N315:
    SA0728 (pgk)
    NCTC8325:
    Newman:
    NWMN_0742 (pgk)
    USA300_FPR3757:
    04-02981:
    SA2981_0751 (pgk)
    08BA02176:
    C248_0864 (pgk)
    11819-97:
    MS7_0824 (pgk)
    71193:
    ST398NM01_0852
    ECT-R 2:
    ECTR2_724
    ED133:
    SAOV_0815
    ED98:
    SAAV_0739 (pgk)
    HO 5096 0412:
    SAEMRSA15_07000 (pgk)
    JH1:
    SaurJH1_0814 (pgk)
    JH9:
    SaurJH9_0798 (pgk)
    JKD6008:
    SAA6008_00788 (pgk)
    JKD6159:
    SAA6159_00730 (pgk)
    LGA251:
    SARLGA251_07070 (pgk)
    M013:
    M013TW_0764
    MRSA252:
    SAR0829 (pgk)
    MSHR1132:
    SAMSHR1132_07190
    MSSA476:
    SAS0739 (pgk)
    Mu3:
    SAHV_0770 (pgk)
    Mu50:
    SAV0773 (pgk)
    MW2:
    MW0735 (pgk)
    RF122:
    SAB0729 (pgk)
    ST398:
    SAPIG0852 (pgk)
    T0131:
    SAT0131_00845
    TCH60:
    HMPREF0772_12405 (pgk)
    TW20:
    SATW20_08480 (pgk)
    USA300_TCH1516:
    USA300HOU_0803 (pgk)
    VC40:
    SAVC_03510 (pgk)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKKIVSDLDLKGKTVLVRADFNVPLKDGEITNDNRIVQALPTIQYIIEQGGKIVLFSHL
    N315            MAKKIVSDLDLKGKTVLVRADFNVPLKDGEITNDNRIVQALPTIQYIIEQGGKIVLFSHL
    NCTC8325        MAKKIVSDLDLKGKTVLVRADFNVPLKDGEITNDNRIVQALPTIQYIIEQGGKIVLFSHL
    Newman          MAKKIVSDLDLKGKTVLVRADFNVPLKDGEITNDNRIVQALPTIQYIIEQGGKIVLFSHL
    USA300_FPR3757  MAKKIVSDLDLKGKTVLVRADFNVPLKDGEITNDNRIVQALPTIQYIIEQGGKIVLFSHL
                    ************************************************************

    COL             GKVKEESDKAKLTLRPVAEDLSKKLDKEVVFVPETRGEKLEAAIKDLKEGDVLLVENTRY
    N315            GKVKEESDKAKLTLRPVAEDLSKKLDKEVVFVPETRGEKLEAAIKDLKEGDVLLVENTRY
    NCTC8325        GKVKEESDKAKLTLRPVAEDLSKKLDKEVVFVPETRGEKLEAAIKDLKEGDVLLVENTRY
    Newman          GKVKEESDKAKLTLRPVAEDLSKKLDKEVVFVPETRGEKLEAAIKDLKEGDVLLVENTRY
    USA300_FPR3757  GKVKEESDKAKLTLRPVAEDLSKKLDKEVVFVPETRGEKLEAAIKDLKEGDVLLVENTRY
                    ************************************************************

    COL             EDLDGKKESKNDPELGKYWASLGDVFVNDAFGTAHREHASNVGISTHLETAAGFLMDKEI
    N315            EDLDGKKESKNDPELGKYWASLGDVFVNDAFGTAHREHASNVGISTHLETAAGFLMDKEI
    NCTC8325        EDLDGKKESKNDPELGKYWASLGDVFVNDAFGTAHREHASNVGISTHLETAAGFLMDKEI
    Newman          EDLDGKKESKNDPELGKYWASLGDVFVNDAFGTAHREHASNVGISTHLETAAGFLMDKEI
    USA300_FPR3757  EDLDGKKESKNDPELGKYWASLGDVFVNDAFGTAHREHASNVGISTHLETAAGFLMDKEI
                    ************************************************************

    COL             KFIGGVVNDPHKPVVAILGGAKVSDKINVIKNLVNIADKIIIGGGMAYTFLKAQGKEIGI
    N315            KFIGGVVNDPHKPVVAILGGAKVSDKINVIKNLVNIADKIIIGGGMAYTFLKAQGKEIGI
    NCTC8325        KFIGGVVNDPHKPVVAILGGAKVSDKINVIKNLVNIADKIIIGGGMAYTFLKAQGKEIGI
    Newman          KFIGGVVNDPHKPVVAILGGAKVSDKINVIKNLVNIADKIIIGGGMAYTFLKAQGKEIGI
    USA300_FPR3757  KFIGGVVNDPHKPVVAILGGAKVSDKINVIKNLVNIADKIIIGGGMAYTFLKAQGKEIGI
                    ************************************************************

    COL             SLLEEDKIDFAKDLLEKHGDKIVLPVDTKVAKEFSNDAKITVVPSDSIPADQEGMDIGPN
    N315            SLLEEDKIDFAKDLLEKHGDKIVLPVDTKVAKEFSNDAKITVVPSDSIPADQEGMDIGPN
    NCTC8325        SLLEEDKIDFAKDLLEKHGDKIVLPVDTKVAKEFSNDAKITVVPSDSIPADQEGMDIGPN
    Newman          SLLEEDKIDFAKDLLEKHGDKIVLPVDTKVAKEFSNDAKITVVPSDSIPADQEGMDIGPN
    USA300_FPR3757  SLLEEDKIDFAKDLLEKHGDKIVLPVDTKVAKEFSNDAKITVVPSDSIPADQEGMDIGPN
                    ************************************************************

    COL             TVKLFADELEGAHTVVWNGPMGVFEFSNFAQGTIGVCKAIANLKDAITIIGGGDSAAAAI
    N315            TVKLFADELEGAHTVVWNGPMGVFEFSNFAQGTIGVCKAIANLKDAITIIGGGDSAAAAI
    NCTC8325        TVKLFADELEGAHTVVWNGPMGVFEFSNFAQGTIGVCKAIANLKDAITIIGGGDSAAAAI
    Newman          TVKLFADELEGAHTVVWNGPMGVFEFSNFAQGTIGVCKAIANLKDAITIIGGGDSAAAAI
    USA300_FPR3757  TVKLFADELEGAHTVVWNGPMGVFEFSNFAQGTIGVCKAIANLKDAITIIGGGDSAAAAI
                    ************************************************************

    COL             SLGFENDFTHISTGGGASLEYLEGKELPGIKAINNK
    N315            SLGFENDFTHISTGGGASLEYLEGKELPGIKAINNK
    NCTC8325        SLGFENDFTHISTGGGASLEYLEGKELPGIKAINNK
    Newman          SLGFENDFTHISTGGGASLEYLEGKELPGIKAINNK
    USA300_FPR3757  SLGFENDFTHISTGGGASLEYLEGKELPGIKAINNK
                    ************************************