From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN002770000
  • symbol?:
  • description?: conserved cytoplasmic protein
  • strand?: -
  • coordinates?: 3243267..3243569
  • synteny block?: BlockID0019730
  • occurrence?: in 56% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0761
    08BA02176:
    11819-97:
    MS7_0833
    71193:
    ECT-R 2:
    ECTR2_733
    ED133:
    ED98:
    SAAV_0751
    HO 5096 0412:
    JH1:
    SaurJH1_0823
    JH9:
    SaurJH9_0807
    JKD6008:
    SAA6008_00797
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_0803
    Mu50:
    SAV0807
    MW2:
    RF122:
    ST398:
    T0131:
    SAT0131_00876
    TCH60:
    TW20:
    SATW20_08570
    USA300_TCH1516:
    USA300HOU_0813
    VC40:
    SAVC_03555

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNNEELEMRLLLMKQSIEQLQEELAPNLKTRDLVLLRYMYSYKEINMLDSYLFQLATNKE
    N315            -------MRLLLMKQSIEQLQEELAPNLKTRDLVLLRYMYSYKEINMLDSYLFQLATNKE
    NCTC8325        MNNEELEMRLLLMKQSIEQLQEELAPNLKTRDLVLLRYMYSYKEINMLDSYLFQLATNKE
    Newman          MNNEELEMRLLLMKQSIEQLQEELAPNLKTRDLVLLRYMYSYKEINMLDSYLFQLATNKE
    USA300_FPR3757  MNNEELEMRLLLMKQSIEQLQEELAPNLKTRDLVLLRYMYSYKEINMLDSYLFQLATNKE
                           *****************************************************

    COL             QITKKQFKTKLENIREVPEIPIRQVNDILEGYKNSELYVELINSILK
    N315            QITKKQFKTKLENIREVPEIPIRQVNDILEGYKNSELYVELINSILK
    NCTC8325        QITKKQFKTKLENIREVPEIPIRQVNDILEGYKNSELYVELINSILK
    Newman          QITKKQFKTKLENIREVPEIPIRQVNDILEGYKNSELYVELINSILK
    USA300_FPR3757  QITKKQFKTKLENIREVPEIPIRQVNDILEGYKNSELYVELINSILK
                    ***********************************************