From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002804000
  • symbol?:
  • description?: Phage protein
  • strand?: -
  • coordinates?: 3271164..3271448
  • synteny block?: BlockID0019950
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0773
    08BA02176:
    C248_0888
    11819-97:
    MS7_0846
    71193:
    ST398NM01_0874
    ECT-R 2:
    ECTR2_746
    ED133:
    SAOV_0835c
    ED98:
    SAAV_0764
    HO 5096 0412:
    SAEMRSA15_07210
    JH1:
    SaurJH1_0835
    JH9:
    SaurJH9_0819
    JKD6008:
    SAA6008_00810
    JKD6159:
    SAA6159_00750
    LGA251:
    SARLGA251_07260
    M013:
    M013TW_0785
    MRSA252:
    SAR0850
    MSHR1132:
    SAMSHR1132_07430
    MSSA476:
    SAS0759
    Mu3:
    SAHV_0814
    Mu50:
    SAV0818
    MW2:
    MW0772
    RF122:
    SAB0751c
    ST398:
    SAPIG0874
    T0131:
    SAT0131_00895
    TCH60:
    HMPREF0772_12384
    TW20:
    SATW20_08690
    USA300_TCH1516:
    USA300HOU_0826
    VC40:
    SAVC_03620

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNELTKEQKYTIAKFYKLYIERSNKGETETVANFFGDAKDARENYFCDRDYQDFLTNCQI
    N315            MNELTKEQKYTIAKFYKLYIERSNNGETETVANFFGDAKDARENYFCDRDYQDFLTNCQI
    NCTC8325        MNELTKEQKYTIAKFYKLYIERSNKGETETVANFFGDAKDARENYFCDRDYQDFLTNCQI
    Newman          MNELTKEQKYTIAKFYKLYIERSNKGETETVANFFGDAKDARENYFCDRDYQDFLTNCQI
    USA300_FPR3757  MNELTKEQKYTIAKFYKLYIERSNKGETETVANFFGDAKDARENYFCDRDYQDFLTNCQI
                    ************************:***********************************

    COL             LIQNKYLTGEVLDDNIYNISILNKTFIEFEQNFG
    N315            LIQNKYLTGEILDDNIYNISILNKTFIEFEQNFG
    NCTC8325        LIQNKYLTGEVLDDNIYNISILNKTFIEFEQNFG
    Newman          LIQNKYLTGEVLDDNIYNISILNKTFIEFEQNFG
    USA300_FPR3757  LIQNKYLTGEVLDDNIYNISILNKTFIEFEQNFG
                    **********:***********************