Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002809000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 3273447..3273668
  • synteny block?: BlockID0020000
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0777
    08BA02176:
    C248_0891
    11819-97:
    MS7_0849
    71193:
    ST398NM01_0878
    ECT-R 2:
    ECTR2_750
    ED133:
    SAOV_0839
    ED98:
    SAAV_0769
    HO 5096 0412:
    SAEMRSA15_07250
    JH1:
    SaurJH1_0839
    JH9:
    SaurJH9_0822
    JKD6008:
    SAA6008_00813
    JKD6159:
    SAA6159_00754
    LGA251:
    SARLGA251_07290
    M013:
    M013TW_0788
    MRSA252:
    SAR0854
    MSHR1132:
    SAMSHR1132_07470
    MSSA476:
    SAS0763
    Mu3:
    SAHV_0818
    Mu50:
    SAV0822
    MW2:
    MW0776
    RF122:
    ST398:
    SAPIG0878
    T0131:
    SAT0131_00897 (groES)
    TCH60:
    HMPREF0772_12380
    TW20:
    SATW20_08720
    USA300_TCH1516:
    USA300HOU_0829
    VC40:
    SAVC_03640

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MTFYNFIMGFQNDNTPFGILAEHVSEDKAFPRLEERHQVIRAYVMSNYTDHQLIETTNRA
    NCTC8325        MTFYNFIMGFQNDNTPFGILAEHVSEDKAFPRLEERHQVIRAYVMSNYTDHQLIETTNRA
    Newman          MTFYNFIMGFQNDNTPFGILAEHVSEDKAFPRLEERHQVIRAYVMSNYTDHQLIETTNRA
    USA300_FPR3757  MTFYNFIMGFQNDNTPFGILAEHVSEDKAFPRLEERHQVIRAYVMSNYTDHQLIETTNRA
                    ************************************************************

    N315            ISLYMAN
    NCTC8325        ISLYMAN
    Newman          ISLYMAN
    USA300_FPR3757  ISLYMAN
                    *******