From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002811000
  • symbol?:
  • description?: phosphoglycerate mutase

      descriptions from strain specific annotations:

    • phosphoglycerate mutase
    • phosphoglycerate mutase family protein
    • Phosphoglycerate mutase family
    • histidine phosphatase super family protein
  • strand?: +
  • coordinates?: 3274118..3274559
  • synteny block?: BlockID0020020
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0779
    08BA02176:
    C248_0893
    11819-97:
    MS7_0851
    71193:
    ST398NM01_0879
    ECT-R 2:
    ECTR2_751
    ED133:
    SAOV_0841
    ED98:
    SAAV_0771
    HO 5096 0412:
    SAEMRSA15_07270
    JH1:
    SaurJH1_0841
    JH9:
    SaurJH9_0824
    JKD6008:
    SAA6008_00815 (gpmA1)
    JKD6159:
    SAA6159_00756 (gpmA1)
    LGA251:
    SARLGA251_07310
    M013:
    M013TW_0790
    MRSA252:
    SAR0856
    MSHR1132:
    SAMSHR1132_07490
    MSSA476:
    SAS0765
    Mu3:
    SAHV_0820
    Mu50:
    SAV0824
    MW2:
    MW0778
    RF122:
    SAB0756
    ST398:
    SAPIG0879
    T0131:
    SAT0131_00899
    TCH60:
    HMPREF0772_12378
    TW20:
    SATW20_08740
    USA300_TCH1516:
    USA300HOU_0831 (gpmA1)
    VC40:
    SAVC_03650

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLLLAKTLYLMRHGQTLFNFKGLIQGFGDSPLTELGIAQAQKARSYYETKGINFDLYASS
    N315            ---MAKTLYLMRHGQTLFNFKGLIQGFGDSPLTELGIAQAQKARSYYETKGINFDLYASS
    NCTC8325        ----------MRHGQTLFNFKGLIQGFGDSPLTELGIAQAQKARSYYETKGINFDLYASS
    Newman          ---MAKTLYLMRHGQTLFNFKGLIQGFGDSPLTELGIAQAQKARSYYETKGINFDLYASS
    USA300_FPR3757  ----------MRHGQTLFNFKGLIQGFGDSPLTELGIAQAQKARSYYETKGINFDLYASS
                              **************************************************

    COL             TQERASDTLENVAPNQSYQRFKGLKEWHFGIFEGESVYLFDNLYKPEDLFGDRIVPFKGE
    N315            TQERASDTLENVAPNQSYQRFKGLKEWHFGIFEGESVYLFDNLYKPEDLFGDRIVPFKGE
    NCTC8325        TQERASDTLENVAPNQSYQRFKGLKEWHFGIFEGESVYLFDNLYKPEDLFGDRIVPFKGE
    Newman          TQERASDTLENVAPNQSYQRFKGLKEWHFGIFEGESVYLFDNLYKPEDLFGDRIVPFKGE
    USA300_FPR3757  TQERASDTLENVAPNQSYQRFKGLKEWHFGIFEGESVYLFDNLYKPEDLFGDRIVPFKGE
                    ************************************************************

    COL             ARQQVEERIVKTLHDIMSQTKNNALVVSHGTIMGVFLRYCLKLDEALKHNIGNCNILKFE
    N315            ARQQVEERIVKTLHDIMSQTKNNALVVSHGTIMGVFLRYCLKLDEALKHNIGNCNILKFE
    NCTC8325        ARQQVEERIVKTLHDIMSQTKNNALVVSHGTIMGVFLRYCLKLDEALKHNIGNCNILKFE
    Newman          ARQQVEERIVKTLHDIMSQTKNNALVVSHGTIMGVFLRYCLKLDEALKHNIGNCNILKFE
    USA300_FPR3757  ARQQVEERIVKTLHDIMSQTKNNALVVSHGTIMGVFLRYCLKLDEALKHNIGNCNILKFE
                    ************************************************************

    COL             YDNGTFKFVELIDPNL
    N315            YDNGTFKFVELIDPNL
    NCTC8325        YDNGTFKFVELIDPNL
    Newman          YDNGTFKFVELIDPNL
    USA300_FPR3757  YDNGTFKFVELIDPNL
                    ****************