From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002813000
  • symbol?:
  • description?: N-acetyltransferase

      descriptions from strain specific annotations:

    • N-acetyltransferase
    • acetyltransferase
    • GNAT family acetyltransferase
    • lactococcal prophage ps3 protein 05
    • MW0780 protein
  • strand?: -
  • coordinates?: 3275571..3276065
  • synteny block?: BlockID0020040
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0781
    08BA02176:
    C248_0895
    11819-97:
    MS7_0853
    71193:
    ST398NM01_0881
    ECT-R 2:
    ECTR2_753
    ED133:
    SAOV_0843c
    ED98:
    SAAV_0773
    HO 5096 0412:
    SAEMRSA15_07290
    JH1:
    SaurJH1_0843
    JH9:
    SaurJH9_0826
    JKD6008:
    SAA6008_00817
    JKD6159:
    SAA6159_00758
    LGA251:
    SARLGA251_07330
    M013:
    M013TW_0792
    MRSA252:
    SAR0858
    MSHR1132:
    SAMSHR1132_07510
    MSSA476:
    SAS0767
    Mu3:
    SAHV_0822
    Mu50:
    SAV0826
    MW2:
    MW0780
    RF122:
    SAB0758c
    ST398:
    SAPIG0881
    T0131:
    SAT0131_00901
    TCH60:
    HMPREF0772_12376
    TW20:
    SATW20_08760
    USA300_TCH1516:
    USA300HOU_0833
    VC40:
    SAVC_03660

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIEIKTLTNNDFNEYKRLVSTVNEEFTQDSHYSQTMTDTLIHDILNQGSPKCIVFGCYEN
    N315            MIEIKTLTNNDFNEYKRLVSTVNEEFTQDSHYSQTMTDTLIHDILNQGSPKCIVFGCYEN
    NCTC8325        MIEIKTLTNNDFNEYKRLVSTVNEEFTQDSHYSQTMTDTLIHDILNQGSPKCIVFGCYEN
    Newman          MIEIKTLTNNDFNEYKRLVSTVNEEFTQDSHYSQTMTDTLIHDILNQGSPKCIVFGCYEN
    USA300_FPR3757  MIEIKTLTNNDFNEYKRLVSTVNEEFTQDSHYSQTMTDTLIHDILNQGSPKCIVFGCYEN
                    ************************************************************

    COL             ETLIATAALEQIRYVGKEHKSLIKYNFVTNNDKSINSELINFIINYARQNNYEYLLTSIV
    N315            ETLIATAALEQIRYVGKEHKSLIKYNFVTNNDKSINSELINFIINYARQNNYESLLTSIV
    NCTC8325        ETLIATAALEQIRYVGKEHKSLIKYNFVTNNDKSINSELINFIINYARQNNYESLLTSIV
    Newman          ETLIATAALEQIRYVGKEHKSLIKYNFVTNNDKSINSELINFIINYARQNNYESLLTSIV
    USA300_FPR3757  ETLIATAALEQIRYVGKEHKSLIKYNFVTNNDKSINSELINFIINYARQNNYESLLTSIV
                    ***************************************************** ******

    COL             SNNIGAKVFYSALGFDILGFEKNAIKIGNTYFDEHWLFYDLINK
    N315            SNNIGAKVFYSALGFDILGFEKNAIKIGNTYFDEHWLFYDLINK
    NCTC8325        SNNIGAKVFYSALGFDILGFEKNAIKIGNTYFDEHWLFYDLINK
    Newman          SNNIGAKVFYSALGFDILGFEKNAIKIGNTYFDEHWLFYDLINK
    USA300_FPR3757  SNNIGAKVFYSALGFDILGFEKNAIKIGNTYFDEHWLFYDLINK
                    ********************************************