From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002816000
  • symbol?: ohr
  • description?: general stress protein

      descriptions from strain specific annotations:

    • general stress protein
    • OsmC family protein
    • OsmC/Ohr family protein
    • Organic hydroperoxide resistance protein
    • organic hydroperoxide reductase
    • OsmC-like protein
    • osmotiCALL import_20_25_26_pangenomey inducible protein OsmC
    • Organic hydroperoxide resistance protein-like protein
    • organic hydroperoxide resistance protein ohrB
  • strand?: -
  • coordinates?: 3276487..3276911
  • synteny block?: BlockID0020070
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0783
    08BA02176:
    C248_0896
    11819-97:
    MS7_0854 (ohrB)
    71193:
    ST398NM01_0882
    ECT-R 2:
    ECTR2_754
    ED133:
    SAOV_0844c
    ED98:
    SAAV_0774
    HO 5096 0412:
    SAEMRSA15_07300
    JH1:
    SaurJH1_0844
    JH9:
    SaurJH9_0827
    JKD6008:
    SAA6008_00818 (osmC)
    JKD6159:
    SAA6159_00759 (osmC)
    LGA251:
    SARLGA251_07340
    M013:
    M013TW_0793
    MRSA252:
    SAR0859
    MSHR1132:
    SAMSHR1132_07520
    MSSA476:
    SAS0768
    Mu3:
    SAHV_0824
    Mu50:
    SAV0828
    MW2:
    MW0781
    RF122:
    SAB0759c
    ST398:
    SAPIG0882
    T0131:
    SAT0131_00902
    TCH60:
    HMPREF0772_12375
    TW20:
    SATW20_08770
    USA300_TCH1516:
    USA300HOU_0835 (osmC)
    VC40:
    SAVC_03665

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAIHYETKATNVGGRKGHVYTDDRALDIDIVPPAQADGKATNPEQLFAAGYASCFNGAFD
    N315            MAIHYETKATNVGGRKGHVYTDDRALDIDIVPPAQADGKATNPEQLFAAGYASCFNGAFD
    NCTC8325        MAIHYETKATNVGGRKGHVYTDDRALDIDIVPPAQADGKATNPEQLFAAGYASCFNGAFD
    Newman          MAIHYETKATNVGGRKGHVYTDDRALDIDIVPPAQADGKATNPEQLFAAGYASCFNGAFD
    USA300_FPR3757  MAIHYETKATNVGGRKGHVYTDDRALDIDIVPPAQADGKATNPEQLFAAGYASCFNGAFD
                    ************************************************************

    COL             LILKQNKVRDAHPEVTLTVRLEDDSDSESPKLSVSIDATIKNVISQEEAEKYLQMAHEFC
    N315            LILKQNKVRDAHPEVTLTVRLEDDSDSESPKLSVSIDATIKNVISQEEAEKYLQMAHEFC
    NCTC8325        LILKQNKVRDAHPEVTLTVRLEDDSDSESPKLSVSIDATIKNVISQEEAEKYLQMAHEFC
    Newman          LILKQNKVRDAHPEVTLTVRLEDDSDSESPKLSVSIDATIKNVISQEEAEKYLQMAHEFC
    USA300_FPR3757  LILKQNKVRDAHPEVTLTVRLEDDSDSESPKLSVSIDATIKNVISQEEAEKYLQMAHEFC
                    ************************************************************

    COL             PYSKATQGNINVDLNVNVVD
    N315            PYSKATQGNINVDLNVNVVD
    NCTC8325        PYSKATQGNINVDLNVNVVD
    Newman          PYSKATQGNINVDLNVNVVD
    USA300_FPR3757  PYSKATQGNINVDLNVNVVD
                    ********************