From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002818000
  • symbol?:
  • description?: nitroreductase

      descriptions from strain specific annotations:

    • nitroreductase
    • nitroreductase family protein
    • putative nitroreductase family protein
  • strand?: +
  • coordinates?: 3277861..3278226
  • synteny block?: BlockID0020090
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0785
    08BA02176:
    C248_0898
    11819-97:
    MS7_0856
    71193:
    ST398NM01_0884
    ECT-R 2:
    ECTR2_756
    ED133:
    SAOV_0846
    ED98:
    SAAV_0776
    HO 5096 0412:
    SAEMRSA15_07320
    JH1:
    SaurJH1_0846
    JH9:
    SaurJH9_0829
    JKD6008:
    SAA6008_00820
    JKD6159:
    SAA6159_00761
    LGA251:
    SARLGA251_07360
    M013:
    M013TW_0795
    MRSA252:
    SAR0861
    MSHR1132:
    SAMSHR1132_07540
    MSSA476:
    SAS0770
    Mu3:
    SAHV_0826
    Mu50:
    SAV0830
    MW2:
    MW0783
    RF122:
    SAB0761
    ST398:
    SAPIG0884
    T0131:
    SAT0131_00904
    TCH60:
    HMPREF0772_12373
    TW20:
    SATW20_08790
    USA300_TCH1516:
    USA300HOU_0837
    VC40:
    SAVC_03675

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MELQQAIANRRSVKKFKRDMHIDDALLYQAIEKAADAPNHGMREPWRVVHVPKDRLGDMS
    N315            MELQQAIANRRSVKKFKRDMHIDDALLYQAIEKAADAPNHGMREPWRVVHVPKDRLGDMS
    NCTC8325        MELQQAIANRRSVKKFKRDMHIDDALLYQAIEKAADAPNHGMREPWRVVHVPKDRLGDMS
    Newman          MELQQAIANRRSVKKFKRDMHIDDALLYQAIEKAADAPNHGMREPWRVVHVPKDRLGDMS
    USA300_FPR3757  MELQQAIANRRSVKKFKRDMHIDDALLYQAIEKAADAPNHGMREPWRVVHVPKDRLGDMS
                    ************************************************************

    COL             KDISKFAFPNELDKQQCHYDAVTKLGGMLLLILKTDPRQRQNDENYFAFGAYAQNLMLLL
    N315            KDISKFAFPNELDKQQCHYDAVTKLGGMLLLILKTDPRQRQNDENYFAFGAYAQNLMLLL
    NCTC8325        KDISKFAFPNELDKQQCHYDAVTKLGGMLLLILKTDPRQRQNDENYFAFGAYAQNLMLLL
    Newman          KDISKFAFPNELDKQQCHYDAVTKLGGMLLLILKTDPRQRQNDENYFAFGAYAQNLMLLL
    USA300_FPR3757  KDISKFAFPNELDKQQCHYDAVTKLGGMLLLILKTDPRQRQNDENYFAFGAYAQNLMLLL
                    ************************************************************

    COL             YEAGIGTCWKSPLYIYDPKVRKTLGIKKDEVLAGFLYLTDLEGDMPKAPRKNRNLITLY
    N315            YEAGIGTCWKSPLYIYDPKVRKTLGIKKDEVLAGFLYLTDLEEDMPKAPRKNRNLITLY
    NCTC8325        YEAGIGTCWKSPLYIYDPKVRKTLGIKKDEVLAGFLYLTDLEEDMPKAPRKNRNLITLY
    Newman          YEAGIGTCWKSPLYIYDPKVRKTLGIKKDEVLAGFLYLTDLEGDMPKAPRKNRNLITLY
    USA300_FPR3757  YEAGIGTCWKSPLYIYDPKVRKTLGIKKDEVLAGFLYLTDLEGDMPKAPRKNRNLITLY
                    ****************************************** ****************