Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002839000
  • symbol?: metP1
  • description?: ABC transporter permease

      descriptions from strain specific annotations:

    • ABC transporter permease
    • binding-protein-dependent transport system inner membrane protein
    • Methionine ABC transporter permease protein
    • D-methionine transport system permease protein metI
    • ABC transporter ATP-binding protein
    • methionine import system permease protein metI
    • ABC superfamily ATP binding cassette transporter, membrane protein
    • methionine ABC transporter permease
    • ABC transporter, permease protein
  • strand?: +
  • coordinates?: 3290753..3291448
  • synteny block?: BlockID0020230
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0793
    08BA02176:
    C248_0907
    11819-97:
    MS7_0865 (metI)
    71193:
    ST398NM01_0893
    ECT-R 2:
    ECTR2_765
    ED133:
    SAOV_0855
    ED98:
    SAAV_0785
    HO 5096 0412:
    SAEMRSA15_07410
    JH1:
    SaurJH1_0855
    JH9:
    SaurJH9_0839
    JKD6008:
    SAA6008_00836
    JKD6159:
    SAA6159_00769
    LGA251:
    SARLGA251_07440
    M013:
    M013TW_0804
    MRSA252:
    SAR0871
    MSHR1132:
    SAMSHR1132_07620
    MSSA476:
    SAS0780
    Mu3:
    SAHV_0834
    Mu50:
    SAV0838
    MW2:
    MW0791
    RF122:
    SAB0769
    ST398:
    SAPIG0893
    T0131:
    SAT0131_00913 (agrA)
    TCH60:
    HMPREF0772_12365
    TW20:
    SATW20_08870
    USA300_TCH1516:
    USA300HOU_0848
    VC40:
    SAVC_03725

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGKSFSEIINEMITMPNIQWPEVWTAIVETLYMTVVSTIFAFILGLILGVLLFLSAKGKS
    N315            MGKSFSEIINEMITMPNIQWPEVWTAIVETLYMTVVSTIFAFILGLILGVLLFLSAKGKS
    NCTC8325        MGKSFSEIINEMITMPNIQWPEVWTAIVETLYMTVVSTIFAFILGLILGVLLFLSAKGKS
    Newman          MGKSFSEIINEMITMPNIQWPEVWTAIVETLYMTVVSTIFAFILGLILGVLLFLSAKGKS
    USA300_FPR3757  MGKSFSEIINEMITMPNIQWPEVWTAIVETLYMTVVSTIFAFILGLILGVLLFLSAKGKS
                    ************************************************************

    COL             IGARLFYSIVSFIVNLFRAIPFIILILLLIPFTSLILGTISGPTGALPALIIGAAPFYAR
    N315            IGARLFYSIVSFIVNLFRAIPFIILILLLIPFTSLILGTISGPTGALPALIIGAAPFYAR
    NCTC8325        IGARLFYSIVSFIVNLFRAIPFIILILLLIPFTSLILGTISGPTGALPALIIGAAPFYAR
    Newman          IGARLFYSIVSFIVNLFRAIPFIILILLLIPFTSLILGTISGPTGALPALIIGAAPFYAR
    USA300_FPR3757  IGARLFYSIVSFIVNLFRAIPFIILILLLIPFTSLILGTISGPTGALPALIIGAAPFYAR
                    ************************************************************

    COL             LVEIAFKEIDKGVIEAAWSMGANTWTVIRKVLLPEAMPALVSGITVTAIALVGSTAVAGV
    N315            LVEIAFKEIDKGVIEAAWSMGANTWIVIRKVLLPEAMPALVSGITVTAIALVGSTAVAGV
    NCTC8325        LVEIAFKEIDKGVIEAAWSMGANTWTVIRKVLLPEAMPALVSGITVTAIALVGSTAVAGV
    Newman          LVEIAFKEIDKGVIEAAWSMGANTWTVIRKVLLPEAMPALVSGITVTAIALVGSTAVAGV
    USA300_FPR3757  LVEIAFKEIDKGVIEAAWSMGANTWTVIRKVLLPEAMPALVSGITVTAIALVGSTAVAGV
                    ************************* **********************************

    COL             IGAGGLGNLAYLTGFTRNQNDVILVSTVFILIIVFIIQFIGDWLTNKLDKR
    N315            IGAGGLGNLAYLTGFTRNQNDVILVSTVFILIIVFIIQFIGDWLTNKLDKR
    NCTC8325        IGAGGLGNLAYLTGFTRNQNDVILVSTVFILIIVFIIQFIGDWLTNKLDKR
    Newman          IGAGGLGNLAYLTGFTRNQNDVILVSTVFILIIVFIIQFIGDWLTNKLDKR
    USA300_FPR3757  IGAGGLGNLAYLTGFTRNQNDVILVSTVFILIIVFIIQFIGDWLTNKLDKR
                    ***************************************************