From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002895000
  • symbol?: sufD
  • description?: ABC transporter

      descriptions from strain specific annotations:

    • ABC transporter
    • FeS assembly protein SufD
    • Iron-sulfur cluster assembly protein SufD
    • ABC transporter ATP-binding protein
    • ABC superfamily ATP binding cassette transporter, membrane protein
    • Sufd
  • strand?: +
  • coordinates?: 3340308..3341612
  • synteny block?: BlockID0020610
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0915 (sufD)
    N315:
    NCTC8325:
    Newman:
    NWMN_0786 (sufD)
    USA300_FPR3757:
    04-02981:
    SA2981_0798 (sufD)
    08BA02176:
    C248_0912
    11819-97:
    MS7_0870 (sufD)
    71193:
    ST398NM01_0898
    ECT-R 2:
    ECTR2_770 (sufD)
    ED133:
    SAOV_0860
    ED98:
    SAAV_0814 (sufD)
    HO 5096 0412:
    SAEMRSA15_07450
    JH1:
    SaurJH1_0860
    JH9:
    SaurJH9_0844
    JKD6008:
    SAA6008_00865 (sufD)
    JKD6159:
    SAA6159_00774 (sufD)
    LGA251:
    SARLGA251_07720
    M013:
    M013TW_0835
    MRSA252:
    SAR0877
    MSHR1132:
    SAMSHR1132_07670
    MSSA476:
    SAS0785
    Mu3:
    SAHV_0839
    Mu50:
    SAV0843
    MW2:
    MW0796
    RF122:
    SAB0775
    ST398:
    SAPIG0898 (sufD)
    T0131:
    SAT0131_00942 (leuD)
    TCH60:
    HMPREF0772_12333 (sufD)
    TW20:
    SATW20_09150
    USA300_TCH1516:
    USA300HOU_0871
    VC40:
    SAVC_03750

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTTDILNISEEQLVDYSKAHNEPSWMTELRKKALKLTETLEMPKPDKTKLRKWDFDSFKQ
    N315            MTTDILNISEEQLVDYSKAHNEPSWMTELRKKALKLTETLEMPKPDKTKLRKWDFDSFKQ
    NCTC8325        MTTDILNISEEQLVDYSKAHNEPSWMTELRKKALKLTETLEMPKPDKTKLRKWDFDSFKQ
    Newman          MTTDILNISEEQLVDYSKAHNEPSWMTELRKKALKLTETLEMPKPDKTKLRKWDFDSFKQ
    USA300_FPR3757  MTTDILNISEEQLVDYSKAHNEPSWMTELRKKALKLTETLEMPKPDKTKLRKWDFDSFKQ
                    ************************************************************

    COL             HDVKGDVYQSLSQLPESVREIIDVDHSKNLVIQHNNTIAYTQVDDNASKDGVIVEGLADA
    N315            HDVKGDVYQSLSQLPESVREIIDVDHSKNLVIQHNNTIAYTQVDDNASKDGVIVEGLADA
    NCTC8325        HDVKGDVYQSLSQLPESVREIIDVDHSKNLVIQHNNTIAYTQVDDNASKDGVIVEGLADA
    Newman          HDVKGDVYQSLSQLPESVREIIDVDHSKNLVIQHNNTIAYTQVDDNASKDGVIVEGLADA
    USA300_FPR3757  HDVKGDVYQSLSQLPESVREIIDVDHSKNLVIQHNNTIAYTQVDDNASKDGVIVEGLADA
                    ************************************************************

    COL             LMNHSDLVQKYFMKDAVTVDEHRITALHTALVNGGVFVYVPKNVVVEHPVQYVVLHDDEN
    N315            LMNHSDLVQKHFMKDAVTVDEHRITALHTALVNGGVFVYVPKNVVVEHPVQYVVLHDDKN
    NCTC8325        LMNHSDLVQKYFMKDAVTVDEHRITALHTALVNGGVFVYVPKNVVVEHPVQYVVLHDDEN
    Newman          LMNHSDLVQKYFMKDAVTVDEHRITALHTALVNGGVFVYVPKNVVVEHPVQYVVLHDDEN
    USA300_FPR3757  LMNHSDLVQKYFMKDAVTVDEHRITALHTALVNGGVFVYVPKNVVVEHPVQYVVLHDDEN
                    **********:***********************************************:*

    COL             ASFYNHVIIVTEESAEVTYVENYLSNASGEGNQLNIISEVIAGANSNITYGSVDYMDKGF
    N315            ASFYNHVIIVTEESAEVTYVENYLSNASGEGNQLNIISEVIAGANSNITYGSVDYMDKGF
    NCTC8325        ASFYNHVIIVTEESAEVTYVENYLSNASGEGNQLNIISEVIAGANSNITYGSVDYMDKGF
    Newman          ASFYNHVIIVTEESAEVTYVENYLSNASGEGNQLNIISEVIAGANSNITYGSVDYMDKGF
    USA300_FPR3757  ASFYNHVIIVTEESAEVTYVENYLSNASGEGNQLNIISEVIAGANSNITYGSVDYMDKGF
                    ************************************************************

    COL             TGHIIRRGITEADASINWALGLMNEGSQIIDNTTNLFGDRSTSSLKSVVVGTGEQKINLT
    N315            TGHIIRRGITEADASINWALGLMNEGSQIIDNTTNLFGDRSTSSLKSVVVGTGEQKINLT
    NCTC8325        TGHIIRRGITEADASINWALGLMNEGSQIIDNTTNLFGDRSTSSLKSVVVGTGEQKINLT
    Newman          TGHIIRRGITEADASINWALGLMNEGSQIIDNTTNLFGDRSTSSLKSVVVGTGEQKINLT
    USA300_FPR3757  TGHIIRRGITEADASINWALGLMNEGSQIIDNTTNLFGDRSTSSLKSVVVGTGEQKINLT
                    ************************************************************

    COL             SKIVQYGKETDGYILKHGVMKEHASSVFNGIGYIKHGGTKSIANQESRVLMLSEHARGDA
    N315            SKIVQYGKETDGYILKHGVMKEHASSVFNGIGYIKHGGTKSIANQESRVLMLSEHARGDA
    NCTC8325        SKIVQYGKETDGYILKHGVMKEHASSVFNGIGYIKHGGTKSIANQESRVLMLSEHARGDA
    Newman          SKIVQYGKETDGYILKHGVMKEHASSVFNGIGYIKHGGTKSIANQESRVLMLSEHARGDA
    USA300_FPR3757  SKIVQYGKETDGYILKHGVMKEHASSVFNGIGYIKHGGTKSIANQESRVLMLSEHARGDA
                    ************************************************************

    COL             NPILLIDEDDVQAGHAASVGRVDPDQLYYLMSRGISQREAERLVIHGFLDPVVRELPIED
    N315            NPILLIDEDDVQAGHAASVGRVDPDQLYYLMSRGISQREAERLVIHGFLDPVVRELPIED
    NCTC8325        NPILLIDEDDVQAGHAASVGRVDPDQLYYLMSRGISQREAERLVIHGFLDPVVRELPIED
    Newman          NPILLIDEDDVQAGHAASVGRVDPDQLYYLMSRGISQREAERLVIHGFLDPVVRELPIED
    USA300_FPR3757  NPILLIDEDDVQAGHAASVGRVDPDQLYYLMSRGISQREAERLVIHGFLDPVVRELPIED
                    ************************************************************

    COL             VKRQLREVIERKVSK
    N315            VKRQLREVIERKVSK
    NCTC8325        VKRQLREVIERKVSK
    Newman          VKRQLREVIERKVSK
    USA300_FPR3757  VKRQLREVIERKVSK
                    ***************