From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002898000
  • symbol?: sufU
  • description?: iron-sulfur cluster assembly scaffold protein NifU

      descriptions from strain specific annotations:

    • iron-sulfur cluster assembly scaffold protein NifU
    • NifU domain-containing protein
    • nitrogen fixation protein NifU-like protein
    • NifU family SUF system FeS assembly protein
    • iron-sulfur (Fe-S) cluster formation protein IscU
    • Iron-sulfur cluster assembly scaffold protein IscU
    • Iscu
    • NifU-like protein
    • nitrogen fixation protein NifU
    • putative iron-sulfur cluster assembly scaffold protein for SUF system, SufE2
    • SUF system FeS assembly protein, NifU family
  • strand?: +
  • coordinates?: 3342964..3343428
  • synteny block?: BlockID0020640
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0788 (nifU)
    USA300_FPR3757:
    04-02981:
    SA2981_0800 (uscU)
    08BA02176:
    C248_0914
    11819-97:
    MS7_0872
    71193:
    ST398NM01_0900
    ECT-R 2:
    ECTR2_772
    ED133:
    SAOV_0862
    ED98:
    SAAV_0816
    HO 5096 0412:
    SAEMRSA15_07470
    JH1:
    SaurJH1_0862
    JH9:
    SaurJH9_0846
    JKD6008:
    SAA6008_00867 (iscU)
    JKD6159:
    SAA6159_00776 (iscU)
    LGA251:
    SARLGA251_07740
    M013:
    M013TW_0837
    MRSA252:
    SAR0879
    MSHR1132:
    SAMSHR1132_07690
    MSSA476:
    SAS0787
    Mu3:
    SAHV_0841
    Mu50:
    SAV0845
    MW2:
    MW0798
    RF122:
    SAB0777
    ST398:
    SAPIG0900
    T0131:
    SAT0131_00944
    TCH60:
    HMPREF0772_12331
    TW20:
    SATW20_09170
    USA300_TCH1516:
    USA300HOU_0874 (iscU)
    VC40:
    SAVC_03760

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNFNNLDQLYRSVIMDHYKNPRNKGVLDNGSMTVDMNNPTCGDRIRLTFDIEDGIIKDAK
    N315            MNFNNLDQLYRSVIMDHYKNPRNKGVLDNGSMTVDMNNPTCGDRIRLTFDIEDGIIKDAK
    NCTC8325        MNFNNLDQLYRSVIMDHYKNPRNKGVLDNGSMTVDMNNPTCGDRIRLTFDIEDGIIKDAK
    Newman          MNFNNLDQLYRSVIMDHYKNPRNKGVLDNGSMTVDMNNPTCGDRIRLTFDIEDGIIKDAK
    USA300_FPR3757  MNFNNLDQLYRSVIMDHYKNPRNKGVLDNGSMTVDMNNPTCGDRIRLTFDIEDGIIKDAK
                    ************************************************************

    COL             FEGEGCSISMASASMMTQAVKGHSLGEAMQMSQEFTKMMLGEDYVITEEMGDIEALQGVS
    N315            FEGEGCSISMASASMMTQAVKGHSLGEAMQMSQEFTKMMLGEDYVITEEMGDIEALQGVS
    NCTC8325        FEGEGCSISMASASMMTQAVKGHSLGEAMQMSQEFTKMMLGEDYVITEEMGDIEALQGVS
    Newman          FEGEGCSISMASASMMTQAVKGHSLGEAMQMSQEFTKMMLGEDYVITEEMGDIEALQGVS
    USA300_FPR3757  FEGEGCSISMASASMMTQAVKGHSLGEAMQMSQEFTKMMLGEDYVITEEMGDIEALQGVS
                    ************************************************************

    COL             QFPARIKCATLAWKALEKGTVAKEGKAEGTTEEE
    N315            QFPARIKCATLAWKALEKGTVAKEGKAEGTTEEE
    NCTC8325        QFPARIKCATLAWKALEKGTVAKEGKAEGTTEEE
    Newman          QFPARIKCATLAWKALEKGTVAKEGKAEGTTEEE
    USA300_FPR3757  QFPARIKCATLAWKALEKGTVAKEGKAEGTTEEE
                    **********************************