From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003014000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • pseudogene
  • strand?: -
  • coordinates?: 3408026..3408340
  • synteny block?: BlockID0021220
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0873
    08BA02176:
    C248_0917
    11819-97:
    MS7_0874
    71193:
    ST398NM01_0902
    ECT-R 2:
    ECTR2_774
    ED133:
    SAOV_0865c
    ED98:
    SAAV_0879
    HO 5096 0412:
    SAEMRSA15_07490
    JH1:
    SaurJH1_0935
    JH9:
    SaurJH9_0917
    JKD6008:
    JKD6159:
    SAA6159_00778
    LGA251:
    SARLGA251_08370
    M013:
    M013TW_0839
    MRSA252:
    SAR0881
    MSHR1132:
    SAMSHR1132_07710
    MSSA476:
    SAS0789
    Mu3:
    SAHV_0913
    Mu50:
    SAV0918
    MW2:
    MW0801
    RF122:
    SAB0785c
    ST398:
    SAPIG0902
    T0131:
    TCH60:
    HMPREF0772_12328
    TW20:
    SATW20_09190
    USA300_TCH1516:
    USA300HOU_0877
    VC40:
    SAVC_03770

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYFVLAIFTIISASVSLGYSIQACASSHNINAYYALSRSLPLFLLAIFSLVIHSAIFLIT
    N315            MYFVLAIFTIISASVSLGYSIQACASSHNINAYYALSRSLPLFLLAIFSLVIHSAIFLIT
    NCTC8325        MYFVLAIFTIISASVSLGYSIQACASSHNINAYYALSRSLPLFLLAIFSLVIHSAIFLIT
    Newman          MYFVLAIFTIISASVSLGYSIQACASSHNINAYYALSRSLPLFLLAIFSLVIHSAIFLIT
    USA300_FPR3757  MYFVLAIFTIISASVSLGYSIQACASSHNINAYYALSRSLPLFLLAIFSLVIHSAIFLIT
                    ************************************************************

    COL             ISIAMILVQFLDAIVGYKSEDVFKTYGPLATSVVNLILLIVFLF
    N315            ISIAMILVQFLDAIVGYKSEDVFKTYGPLATSVVNLILLIVFLF
    NCTC8325        ISIAMILVQFLDAIVGYKSEDVFKTYGPLATSVVNLILLIVFLF
    Newman          ISIAMILVQFLDAIVGYKSEDVFKTYGPLATSVVNLILLIVFLF
    USA300_FPR3757  ISIAMILVQFLDAIVGYKSEDVFKTYGPLATSVVNLILLIVFLF
                    ********************************************