From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003020000
  • symbol?:
  • description?: sulfite exporter TauE/SafE-like protein

      descriptions from strain specific annotations:

    • sulfite exporter TauE/SafE-like protein
    • sulfite exporter TauE/SafE family protein
    • conserved protein YunE
    • membrane spanning protein
    • membrane protein
  • strand?: +
  • coordinates?: 3412440..3413267
  • synteny block?: BlockID0021280
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0877
    08BA02176:
    C248_0922
    11819-97:
    MS7_0878
    71193:
    ST398NM01_0906
    ECT-R 2:
    ECTR2_778
    ED133:
    SAOV_0869
    ED98:
    SAAV_0883
    HO 5096 0412:
    SAEMRSA15_07530
    JH1:
    SaurJH1_0940
    JH9:
    SaurJH9_0921
    JKD6008:
    SAA6008_00874
    JKD6159:
    SAA6159_00782
    LGA251:
    SARLGA251_08410
    M013:
    M013TW_0842
    MRSA252:
    SAR0885
    MSHR1132:
    SAMSHR1132_07750
    MSSA476:
    SAS0793
    Mu3:
    SAHV_0917
    Mu50:
    SAV0922
    MW2:
    MW0805
    RF122:
    SAB0789
    ST398:
    SAPIG0906
    T0131:
    SAT0131_00953 (sigB)
    TCH60:
    HMPREF0772_12324
    TW20:
    SATW20_09230
    USA300_TCH1516:
    USA300HOU_0883
    VC40:
    SAVC_03790

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLLTITLLVLIGGLSAIIGSIVGIGGGIIIVPTMVYLGVEHGLLHNITTQVAIGTSSVIL
    N315            MLLTITLLVLIGGLSAIIGSIVGIGGGIIIVPTMVYLGVEHGLLHNITTQVAIGTSSVIL
    NCTC8325        MLLTITLLVLIGGLSAIIGSIVGIGGGIIIVPTMVYLGVEHGLLHNITTQVAIGTSSVIL
    Newman          MLLTITLLVLIGGLSAIIGSIVGIGGGIIIVPTMVYLGVEHGLLHNITTQVAIGTSSVIL
    USA300_FPR3757  MLLTITLLVLIGGLSAIIGSIVGIGGGIIIVPTMVYLGVEHGLLHNITTQVAIGTSSVIL
                    ************************************************************

    COL             IVTGLSSSLGYLKTKQVDIKNGSIFLFGLLPGSLLGSFISRYLTFESFNLYFGIFLIFVA
    N315            IVTGLSSSLGYLKTKQVDIKNGSIFLFGLLPGSLLGSFISRYLTFESFNLYFGIFLIFVA
    NCTC8325        IVTGLSSSLGYLKTKQVDIKNGSIFLFGLLPGSLLGSFISRYLTFESFNLYFGIFLIFVA
    Newman          IVTGLSSSLGYLKTKQVDIKNGSIFLFGLLPGSLLGSFISRYLTFESFNLYFGIFLIFVA
    USA300_FPR3757  IVTGLSSSLGYLKTKQVDIKNGSIFLFGLLPGSLLGSFISRYLTFESFNLYFGIFLIFVA
                    ************************************************************

    COL             ILLMVRNKIKPFKIFDKPKYEKTYVDAKGKTYHYSVPPLFAFITTFLIGILTGLFGIGGG
    N315            ILLMVRNKIKPFKIFDKPKYEKTYVDAKGKTYHYSVPPLFAFITTFLIGILTGLFGIGGG
    NCTC8325        ILLMVRNKIKPFKIFDKPKYEKTYVDAKGKTYHYSVPPLFAFITTFLIGILTGLFGIGGG
    Newman          ILLMVRNKIKPFKIFDKPKYEKTYVDAKGKTYHYSVPPLFAFITTFLIGILTGLFGIGGG
    USA300_FPR3757  ILLMVRNKIKPFKIFDKPKYEKTYVDAKGKTYHYSVPPLFAFITTFLIGILTGLFGIGGG
                    ************************************************************

    COL             ALMTPLMLIVFRFPPHVAVGTSMMMIFFSSVMSSIGHIAQGHVAWGYAIILIISSYFGAK
    N315            ALMTPLMLIVFRFPPHVAVGTSMMMIFFSSVMSSIGHIAQGHVAWGYAIILIISSYFGAK
    NCTC8325        ALMTPLMLIVFRFPPHVAVGTSMMMIFFSSVMSSIGHIAQGHVAWGYAIILIISSYFGAK
    Newman          ALMTPLMLIVFRFPPHVAVGTSMMMIFFSSVMSSIGHIAQGHVAWGYAIILIISSYFGAK
    USA300_FPR3757  ALMTPLMLIVFRFPPHVAVGTSMMMIFFSSVMSSIGHIAQGHVAWGYAIILIISSYFGAK
                    ************************************************************

    COL             IGVKVNQSIKSDTVVTLLRTVMLLMGIYLIIRALI
    N315            IGVKVNQSIKSDTVVTLLRTVMLLMGIYLIIRALI
    NCTC8325        IGVKVNQSIKSDTVVTLLRTVMLLMGIYLIIRALI
    Newman          IGVKVNQSIKSDTVVTLLRTVMLLMGIYLIIRALI
    USA300_FPR3757  IGVKVNQSIKSDTVVTLLRTVMLLMGIYLIIRALI
                    ***********************************