From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003024000
  • symbol?:
  • description?: Alanine racemase domain-containing protein
  • strand?: -
  • coordinates?: 3416210..3417987
  • synteny block?: BlockID0021320
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0882
    08BA02176:
    C248_0926
    11819-97:
    MS7_0882
    71193:
    ST398NM01_0910
    ECT-R 2:
    ECTR2_783
    ED133:
    SAOV_0873c
    ED98:
    SAAV_0887
    HO 5096 0412:
    SAEMRSA15_07570
    JH1:
    SaurJH1_0945
    JH9:
    SaurJH9_0926
    JKD6008:
    SAA6008_00878
    JKD6159:
    SAA6159_00786
    LGA251:
    SARLGA251_08450
    M013:
    M013TW_0846
    MRSA252:
    SAR0889
    MSHR1132:
    SAMSHR1132_07790
    MSSA476:
    SAS0797
    Mu3:
    SAHV_0922
    Mu50:
    SAV0927
    MW2:
    MW0809
    RF122:
    SAB0793c
    ST398:
    SAPIG0910
    T0131:
    SAT0131_00957
    TCH60:
    HMPREF0772_12320
    TW20:
    SATW20_09270
    USA300_TCH1516:
    USA300HOU_0887
    VC40:
    SAVC_03810

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---MYLYDDNEESQVQFVGFVGEHSRYDLMLVHTNRHYGKTLVLNMQTNKFGIIGTDDLK
    N315            MIDMYLYDDNEESQVQFVGFVGEHSRYDLMLVHTNRHYGKTLVLNMQTNKFGIIGTDDLK
    NCTC8325        MIDMYLYDDNEESQVQFVGFVGEHSRYDLMLVHTNRHYGKTLVLNMQTNKFGIIGTDDLK
    Newman          MIDMYLYDDNEESQVQFVGFVGEHSRYDLMLVHTNRHYGKTLVLNMQTNKFGIIGTDDLK
    USA300_FPR3757  MIDMYLYDDNEESQVQFVGFVGEHSRYDLMLVHTNRHYGKTLVLNMQTNKFGIIGTDDLK
                       *********************************************************

    COL             EEGYIAHILGVNAEEGDEITEYLNEVIH
    N315            EEGYIAHILGVNAEEGDEITEYLNEVIH
    NCTC8325        EEGYIAHILGVNAEEGDEITEYLNEVIH
    Newman          EEGYIAHILGVNAEEGDEITEYLNEVIH
    USA300_FPR3757  EEGYIAHILGVNAEEGDEITEYLNEVIH
                    ****************************