From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003026000
  • symbol?:
  • description?: DUF86 domain-containing protein
  • strand?: +
  • coordinates?: 3418094..3418528
  • synteny block?: BlockID0021340
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0883
    08BA02176:
    C248_0927
    11819-97:
    MS7_0883
    71193:
    ST398NM01_0911
    ECT-R 2:
    ECTR2_784
    ED133:
    SAOV_0874
    ED98:
    SAAV_0888
    HO 5096 0412:
    SAEMRSA15_07580
    JH1:
    SaurJH1_0946
    JH9:
    SaurJH9_0927
    JKD6008:
    SAA6008_00879
    JKD6159:
    SAA6159_00787
    LGA251:
    SARLGA251_08460
    M013:
    M013TW_0847
    MRSA252:
    SAR0890
    MSHR1132:
    SAMSHR1132_07800
    MSSA476:
    SAS0798
    Mu3:
    SAHV_0923
    Mu50:
    SAV0928
    MW2:
    MW0810
    RF122:
    SAB0794
    ST398:
    SAPIG0911
    T0131:
    SAT0131_00958
    TCH60:
    HMPREF0772_12319
    TW20:
    SATW20_09280
    USA300_TCH1516:
    USA300HOU_0888
    VC40:
    SAVC_03815

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYFVDKDKLTQKLAYLQALTDDYHESKHNHYAFERIAQMLIESSVDIGNMIIDAFILRDP
    N315            MYFVDKDKLTQKLAYLQALTDDYHESKHNHYAFERIAQMLIESSVDIGNMIIDAFILRDP
    NCTC8325        MYFVDKDKLTQKLAYLQALTDDYHESKHNHYAFERIAQMLIESSVDIGNMIIDAFILRDP
    Newman          MYFVDKDKLTQKLAYLQALTDDYHESKHNHYAFERIAQMLIESSVDIGNMIIDAFILRDP
    USA300_FPR3757  MYFVDKDKLTQKLAYLQALTDDYHESKHNHYAFERIAQMLIESSVDIGNMIIDAFILRDP
                    ************************************************************

    COL             GNYKDVIDILELENVITKETQQAINKTVGIRKQFTYDYTALDIKIIMPMFDDALPYYKQF
    N315            GNYKDVIDILELENVITKETQQEINKTVDIRKQFTYDYTALDIKVIMPMFDDALPYYKQF
    NCTC8325        GNYKDVIDILELENVITKETQQAINKTVGIRKQFTYDYTALDIKIIMPMFDDALPYYKQF
    Newman          GNYKDVIDILELENVITKETQQAINKTVGIRKQFTYDYTALDIKIIMPMFDDALPYYKQF
    USA300_FPR3757  GNYKDVIDILELENVITKETQQAINKTVGIRKQFTYDYTALDIKIIMPMFDDALPYYKQF
                    ********************** *****.***************:***************

    COL             ITEVTTFLHQENVPVTAFGKGENQ
    N315            ITEVTIFLHQENVPVTAFGKGENQ
    NCTC8325        ITEVTIFLHQENVPVTAFGKGENQ
    Newman          ITEVTTFLHQENVPVTAFGKGENQ
    USA300_FPR3757  ITEVTTFLHQENVPVTAFGKGENQ
                    ***** ******************