From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003031000
  • symbol?: dltA
  • description?: D-alanine--poly(phosphoribitol) ligase subunit 1

      descriptions from strain specific annotations:

    • D-alanine--poly(phosphoribitol) ligase subunit 1
    • D-alanine--poly(phosphoribitol) ligase
    • D-alanine-activating enzyme
    • D-alanine-activating enzyme/D-alanine-D-alanyl, dltA protein
    • D-alanine--D-alanine ligase
    • D-alanine--poly(phosphoribitol) ligase, subunit 1
  • strand?: +
  • coordinates?: 3421175..3422632
  • synteny block?: BlockID0021390
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0935 (dltA)
    N315:
    SA0793 (dltA)
    NCTC8325:
    Newman:
    NWMN_0803 (dltA)
    USA300_FPR3757:
    04-02981:
    SA2981_0887 (dltA)
    08BA02176:
    C248_0931 (dltA)
    11819-97:
    MS7_0887 (dltA)
    71193:
    ST398NM01_0915
    ECT-R 2:
    ECTR2_788 (dltA)
    ED133:
    SAOV_0878
    ED98:
    SAAV_0893 (dltA)
    HO 5096 0412:
    SAEMRSA15_07620 (dltA)
    JH1:
    SaurJH1_0951
    JH9:
    SaurJH9_0932
    JKD6008:
    SAA6008_00883 (dltA)
    JKD6159:
    SAA6159_00791 (dltA)
    LGA251:
    SARLGA251_08500 (dltA)
    M013:
    M013TW_0851
    MRSA252:
    SAR0894 (dltA)
    MSHR1132:
    SAMSHR1132_07840
    MSSA476:
    SAS0802
    Mu3:
    SAHV_0927 (dltA)
    Mu50:
    SAV0932 (dltA)
    MW2:
    MW0814 (dltA)
    RF122:
    SAB0798 (dltA)
    ST398:
    SAPIG0915 (dltA)
    T0131:
    SAT0131_00962
    TCH60:
    HMPREF0772_12315 (dltA)
    TW20:
    SATW20_09320 (dltA)
    USA300_TCH1516:
    USA300HOU_0893 (dltA)
    VC40:
    SAVC_03835

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTDIINKLQAFADANPQSIAVRHTTDELTYQQLMDESSKLAHRLQGSKKPMILFGHMSPY
    N315            MTDIINKLQAFADANPQSIAVRHTTDELTYQQLMDESSKLAHRLQGSKKPMILFGHMSPY
    NCTC8325        MTDIINKLQAFADANPQSIAVRHTTDELTYQQLMDESSKLAHRLQGSKKPMILFGHMSPY
    Newman          MTDIINKLQAFADANPQSIAVRHTTDELTYQQLMDESSKLAHRLQGSKKPMILFGHMSPY
    USA300_FPR3757  MTDIINKLQAFADANPQSIAVRHTTDELTYQQLMDESSKLAHRLQGSKKPMILFGHMSPY
                    ************************************************************

    COL             MIVGMIGAIKAGCGYVPVDTSIPEDRIKMIINKVQPEFVFNTTDESFESLEGEVFTIEDI
    N315            MIVGMIGAIKAGCGYVPVDTSIPEDRIKMIINKVQPEFVFNTTDESFESLEGEVFTIEDI
    NCTC8325        MIVGMIGAIKAGCGYVPVDTSIPEDRIKMIINKVQPEFVFNTTDESFESLEGEVFTIEDI
    Newman          MIVGMIGAIKAGCGYVPVDTSIPEDRIKMIINKVQPEFVFNTTDESFESLEGEVFTIEDI
    USA300_FPR3757  MIVGMIGAIKAGCGYVPVDTSIPEDRIKMIINKVQPEFVFNTTDESFESLEGEVFTIEDI
                    ************************************************************

    COL             KTSQDPVIFDSQIKDNDTVYTIFTSGSTGEPKGVQIEYASLVQFTEWMLELNKSGNEQQW
    N315            KTSQDPVIFDSQIKDNDTVYTIFTSGSTGEPKGVQIEYASLVQFTEWMLELNKSGNKQQW
    NCTC8325        KTSQDPVIFDSQIKDNDTVYTIFTSGSTGEPKGVQIEYASLVQFTEWMLELNKSGNEQQW
    Newman          KTSQDPVIFDSQIKDNDTVYTIFTSGSTGEPKGVQIEYASLVQFTEWMLELNKSGNEQQW
    USA300_FPR3757  KTSQDPVIFDSQIKDNDTVYTIFTSGSTGEPKGVQIEYASLVQFTEWMLELNKSGNEQQW
                    ********************************************************:***

    COL             LNQAPFSFDLSVMAIYPCLASGGTLNLVDKNMINKPKLLNEMLTATPINIWVSTPSFMEM
    N315            LNQAPFSFDLSVMAIYPCLASGGTLNLVDKNMINKPKLLNEMLTATPINIWVSTPSFMEM
    NCTC8325        LNQAPFSFDLSVMAIYPCLASGGTLNLVDKNMINKPKLLNEMLTATPINIWVSTPSFMEM
    Newman          LNQAPFSFDLSVMAIYPCLASGGTLNLVDKNMINKPKLLNEMLTATPINIWVSTPSFMEM
    USA300_FPR3757  LNQAPFSFDLSVMAIYPCLASGGTLNLVDKNMINKPKLLNEMLTATPINIWVSTPSFMEM
                    ************************************************************

    COL             CLLLPTLNEEQYGSLNEFFFCGEILPHRAAKALVNRFPSATIYNTYGPTEATVAVTSIQI
    N315            CLLLPTLNEEQYGSLNEFFFCGEILPHRAAKALVSRFPSATIYNTYGPTEATVAVTSIQI
    NCTC8325        CLLLPTLNEEQYGSLNEFFFCGEILPHRAAKALVNRFPSATIYNTYGPTEATVAVTSIQI
    Newman          CLLLPTLNEEQYGSLNEFFFCGEILPHRAAKALVNRFPSATIYNTYGPTEATVAVTSIQI
    USA300_FPR3757  CLLLPTLNEEQYGSLNEFFFCGEILPHRAAKALVNRFPSATIYNTYGPTEATVAVTSIQI
                    **********************************.*************************

    COL             TQEILDQYPTLPVGVERPGARLSTTDEGELVIEGQSVSLGYLKNDQKTAEVFNFDDGIRT
    N315            TQEILDQYPTLPVGVERLGARLSTTDDGELVIEGQSVSLGYLKNDQKTAEVFNFDDGIRT
    NCTC8325        TQEILDQYPTLPVGVERPGARLSTTDEGELVIEGQSVSLGYLKNDQKTAEVFNFDDGIRT
    Newman          TQEILDQYPTLPVGVERPGARLSTTDEGELVIEGQSVSLGYLKNDQKTAEVFNFDDGIRT
    USA300_FPR3757  TQEILDQYPTLPVGVERPGARLSTTDEGELVIEGQSVSLGYLKNDQKTAEVFNFDDGIRT
                    ***************** ********:*********************************

    COL             YHTGDKAKFENGQWFIQGRIDFQIKLNGYRMELEEIETQLRQSEFVKEAIVVPVYKNDKV
    N315            YHTGDKAKFENGQWFIQGRIDFQIKLNGYRMELEEIETQLRQSEFVKEAIVVPVYKNDKV
    NCTC8325        YHTGDKAKFENGQWFIQGRIDFQIKLNGYRMELEEIETQLRQSEFVKEAIVVPVYKNDKV
    Newman          YHTGDKAKFENGQWFIQGRIDFQIKLNGYRMELEEIETQLRQSEFVKEAIVVPVYKNDKV
    USA300_FPR3757  YHTGDKAKFENGQWFIQGRIDFQIKLNGYRMELEEIETQLRQSEFVKEAIVVPVYKNDKV
                    ************************************************************

    COL             IHLIGAIVPTTEVTDNAEMTKNIKNDLKSRLPEYMIPRKFEWMEQLPLTSNGKIDRKKIA
    N315            IHLIGAIVPTTEVTDNAEMTKNIKNDLKSRLPEYMIPRKFEWMEQLPLTSNGKIDRKKIA
    NCTC8325        IHLIGAIVPTTEVTDNAEMTKNIKNDLKSRLPEYMIPRKFEWMEQLPLTSNGKIDRKKIA
    Newman          IHLIGAIVPTTEVTDNAEMTKNIKNDLKSRLPEYMIPRKFEWMEQLPLTSNGKIDRKKIA
    USA300_FPR3757  IHLIGAIVPTTEVTDNAEMTKNIKNDLKSRLPEYMIPRKFEWMEQLPLTSNGKIDRKKIA
                    ************************************************************

    COL             EVING
    N315            EVING
    NCTC8325        EVING
    Newman          EVING
    USA300_FPR3757  EVING
                    *****