From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003034000
  • symbol?: dltD
  • description?: poly (glycerophosphate chain) D-alanine transfer protein

      descriptions from strain specific annotations:

    • poly (glycerophosphate chain) D-alanine transfer protein
    • poly #glycerophosphate chain D-alanine transfer protein
    • poly D-alanine transfer protein
    • lipoteichoic acid biosynthesis protein
    • poly D-alanine transfer protein (glycerophosphate chain)
    • extramembranal protein
    • D-alanyl-lipoteichoic acid biosynthesis protein DltD
    • DltD domain-containing protein
    • putative lipoteichoic acid biosynthesis protein
    • Poly(glycerophosphate chain) D-alanine transfer protein DltD
    • D-alanine lipoteichoic acid and wall teichoic acid esterification secreted protein
    • dltD C-terminal region family protein
    • DltD protein
    • D-alanine-activating DltD protein
    • D-alanine-activating enzyme/D-alanine-D-alanyl, dltD protein
    • DltD, central domain protein
    • protein dltD
  • strand?: +
  • coordinates?: 3424094..3425269
  • synteny block?: BlockID0021420
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0938 (dltD)
    N315:
    SA0796 (dltD)
    NCTC8325:
    Newman:
    NWMN_0806 (dltD)
    USA300_FPR3757:
    04-02981:
    SA2981_0890 (dltD)
    08BA02176:
    C248_0934 (dltD)
    11819-97:
    MS7_0890 (dltD)
    71193:
    ST398NM01_0918
    ECT-R 2:
    ECTR2_791
    ED133:
    SAOV_0881
    ED98:
    SAAV_0896 (dltD)
    HO 5096 0412:
    SAEMRSA15_07650 (dltD)
    JH1:
    SaurJH1_0954
    JH9:
    SaurJH9_0935
    JKD6008:
    SAA6008_00886 (dltD)
    JKD6159:
    SAA6159_00794 (dltD)
    LGA251:
    SARLGA251_08530 (dltD)
    M013:
    M013TW_0854
    MRSA252:
    SAR0897 (dltD)
    MSHR1132:
    SAMSHR1132_07870
    MSSA476:
    SAS0805
    Mu3:
    SAHV_0930 (dltD)
    Mu50:
    SAV0935 (dltD)
    MW2:
    MW0817 (dltD)
    RF122:
    SAB0801 (dltD)
    ST398:
    SAPIG0918
    T0131:
    SAT0131_00965 (kdpC)
    TCH60:
    HMPREF0772_12312 (dltD)
    TW20:
    SATW20_09350 (dltD)
    USA300_TCH1516:
    USA300HOU_0896 (dltD)
    VC40:
    SAVC_03850

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKLKPFLPILISGAVFIVFLLLPASWFTGLVNEKTVEDNRTSLTDQVLKGTLIQDKLYES
    N315            MKLKPFLPILISGAVFIVFLLLPASWFTGLVNEKTVEDNRTSLTDQVLKGTLIQDKLYES
    NCTC8325        MKLKPFLPILISGAVFIVFLLLPASWFTGLVNEKTVEDNRTSLTDQVLKGTLIQDKLYES
    Newman          MKLKPFLPILISGAVFIVFLLLPASWFTGLVNEKTVEDNRTSLTDQVLKGTLIQDKLYES
    USA300_FPR3757  MKLKPFLPILISGAVFIVFLLLPASWFTGLVNEKTVEDNRTSLTDQVLKGTLIQDKLYES
                    ************************************************************

    COL             NKYYPIYGSSELGKDDPFNPAIALNKHNANKKAFLLGAGGSTDLINAIELASQYDKLKGK
    N315            NKYYPIYGSSELGKDDPFNPAIALNKHNANKKAFLLGAGGSTDLINAVELASQYDKLKGK
    NCTC8325        NKYYPIYGSSELGKDDPFNPAIALNKHNANKKAFLLGAGGSTDLINAVELASQYDKLKGK
    Newman          NKYYPIYGSSELGKDDPFNPAIALNKHNANKKAFLLGAGGSTDLINAIELASQYDKLKGK
    USA300_FPR3757  NKYYPIYGSSELGKDDPFNPAIALNKHNANKKAFLLGAGGSTDLINAVELASQYDKLKGK
                    ***********************************************:************

    COL             KLTFIISPQWFTNHGLTNQNFDARMSQTQINQMFQQKNMSTELKRRYAQRLLQFPHVHNK
    N315            KLTFIISPQWFTNHGLTNQNFDARMSQTQINQMFQQKNMSTELKRRYAQRLLQFPHVHNK
    NCTC8325        KLTFIISPQWFTNHGLTNQNFDARMSQTQINQMFQQKNMSTELKRRYAQRLLQFPHVHNK
    Newman          KLTFIISPQWFTNHGLTNQNFDARMSQTQINQMFQQKNMSTELKRRYAQRLLQFPHVHNK
    USA300_FPR3757  KLTFIISPQWFTNHGLTNQNFDARMSQTQINQMFQQKNMSTELKRRYAQRLLQFPHVHNK
                    ************************************************************

    COL             EYLKSYAKNPKETKDSYISGFKENQLIKIEAIKSLFAMDKSPLEHVKPATKPDASWDEMK
    N315            EYLKSYAKNPKETKDSYISGFKENQLIKIEAIKSLFAMDKSPLEHVKPATKPDASWDEMK
    NCTC8325        EYLKSYAKNPKETKDSYISGFKENQLIKIEAIKSLFAMDKSPLEHVKPATKPDASWDEMK
    Newman          EYLKSYAKNPKETKDSYISGFKENQLIKIEAIKSLFAMDKSPLEHVKPATKPDASWDEMK
    USA300_FPR3757  EYLKSYAKNPKETKDSYISGFKENQLIKIEAIKSLFAMDKSPLEHVKPATKPDASWDEMK
                    ************************************************************

    COL             QKAVEIGKADTTSNKFGIRDQYWKLIQESKRKVRRDYEFNVNSPEFQDLELLVKTMRAAG
    N315            QKAVEIGKADTTSNKFGIRDQYWILIQESKRKVRRDYEFNVNSPEFQDLELLVKTMRAAG
    NCTC8325        QKAVEIGKADTTSNKFGIRDQYWKLIQESKRKVRRDYEFNVNSPEFQDLELLVKTMRAAG
    Newman          QKAVEIGKADTTSNKFGIRDQYWKLIQESKRKVRRDYEFNVNSPEFQDLELLVKTMRAAG
    USA300_FPR3757  QKAVEIGKADTTSNKFGIRDQYWKLIQESKRKVRRDYEFNVNSPEFQDLELLVKTMRAAG
                    *********************** ************************************

    COL             ADVQYVSIPSNGVWYDHIGIDKERRQAVYKKIHSTVVDNGGKIYDMTDKDYEKYVISDAV
    N315            ADVQYVSIPSNGVWYDHIGIDKERRQAVYKKIHSTVVDNGGKIYDMTDKDYEKYVISDAV
    NCTC8325        ADVQYVSIPSNGVWYDHIGIDKERRQAVYKKIHSTVVDNGGKIYDMTDKDYEKYVISDAV
    Newman          ADVQYVSIPSNGVWYDHIGIDKERRQAVYKKIHSTVVDNGGKIYDMTDKDYEKYVISDAV
    USA300_FPR3757  ADVQYVSIPSNGVWYDHIGIDKERRQAVYKKIHSTVVDNGGKIYDMTDKEYEKYVISDAV
                    *************************************************:**********

    COL             HIGWKGWVYMDEQIAKHMKGEPQPEVDKPKN
    N315            HIGWKGWVYMDEQIAKHMKGEPQPEVDKPKN
    NCTC8325        HIGWKGWVYMDEQIAKHMKGEPQPEVDKPKN
    Newman          HIGWKGWVYMDEQIAKHMKGEPQPEVDKPKN
    USA300_FPR3757  HIGWKGWVYMDEQIAKHMKGEPQPEVDKPKN
                    *******************************