From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003035000
  • symbol?: nfu
  • description?: NifU domain-containing protein

      descriptions from strain specific annotations:

    • NifU domain-containing protein
    • nitrogen-fixing NifU domain protein
    • nifU-like domain protein
    • nitrogen-fixing NifU domain-containing protein
    • nitrogen fixation protein NifU
    • nifU-like protein
    • NifU family protein
  • strand?: -
  • coordinates?: 3425568..3425789
  • synteny block?: BlockID0021430
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0891 (nifU)
    08BA02176:
    C248_0935
    11819-97:
    MS7_0891
    71193:
    ST398NM01_0919
    ECT-R 2:
    ECTR2_792
    ED133:
    SAOV_0882c
    ED98:
    SAAV_0897
    HO 5096 0412:
    SAEMRSA15_07660
    JH1:
    SaurJH1_0955
    JH9:
    SaurJH9_0936
    JKD6008:
    SAA6008_00887
    JKD6159:
    SAA6159_00795
    LGA251:
    SARLGA251_08540
    M013:
    M013TW_0855
    MRSA252:
    SAR0898
    MSHR1132:
    SAMSHR1132_07880
    MSSA476:
    SAS0806
    Mu3:
    SAHV_0931
    Mu50:
    SAV0936
    MW2:
    MW0818
    RF122:
    SAB0802c
    ST398:
    SAPIG0919
    T0131:
    SAT0131_00966
    TCH60:
    HMPREF0772_12311 (nifU)
    TW20:
    SATW20_09360
    USA300_TCH1516:
    USA300HOU_0897
    VC40:
    SAVC_03855

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -------MFDQVAEVIERLRPFLLRDGGDCSLIDVEDGIVKLQLHGACGTCPSSTITLKA
    N315            MPTEDTTMFDQVAEVIERLRPFLLRDGGDCSLIDVEDGIVKLQLHGACGTCPSSTITLKA
    NCTC8325        MPTEDTTMFDQVAEVIERLRPFLLRDGGDCSLIDVEDGIVKLQLHGACGTCPSSTITLKA
    Newman          MPTEDTTMFDQVAEVIERLRPFLLRDGGDCSLIDVEDGIVKLQLHGACGTCPSSTITLKA
    USA300_FPR3757  MPTEDTTMFDQVAEVIERLRPFLLRDGGDCSLIDVEDGIVKLQLHGACGTCPSSTITLKA
                           *****************************************************

    COL             GIERALHEEVPGVIEVEQVF
    N315            GIERALHEEVPGVIEVEQVF
    NCTC8325        GIERALHEEVPGVIEVEQVF
    Newman          GIERALHEEVPGVIEVEQVF
    USA300_FPR3757  GIERALHEEVPGVIEVEQVF
                    ********************