From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003038000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 3427695..3427931
  • synteny block?: BlockID0021460
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0894
    08BA02176:
    C248_0938
    11819-97:
    MS7_0894
    71193:
    ST398NM01_0922
    ECT-R 2:
    ECTR2_795
    ED133:
    SAOV_0885
    ED98:
    SAAV_0900
    HO 5096 0412:
    SAEMRSA15_07690
    JH1:
    SaurJH1_0958
    JH9:
    SaurJH9_0939
    JKD6008:
    SAA6008_00890
    JKD6159:
    SAA6159_00798
    LGA251:
    SARLGA251_08570
    M013:
    M013TW_0858
    MRSA252:
    SAR0901
    MSHR1132:
    SAMSHR1132_07910
    MSSA476:
    SAS0809
    Mu3:
    SAHV_0934
    Mu50:
    SAV0939
    MW2:
    MW0821
    RF122:
    SAB0805
    ST398:
    SAPIG0922
    T0131:
    SAT0131_00969 (kdpA)
    TCH60:
    HMPREF0772_12308
    TW20:
    SATW20_09390
    USA300_TCH1516:
    USA300HOU_0900
    VC40:
    SAVC_03870

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNPIVEFCLSNMAKGGDYVFNQLENDPDVDVLEYGCLTHCGICSAGLYALVNGDIVEGDS
    N315            MNPIVEFCLSNMAKGGDYVFNQLENDPDVDVLEYGCLTHCGICSAGLYALVNGDIVEGDS
    NCTC8325        MNPIVEFCLSNMAKGGDYVFNQLENDPDVDVLEYGCLTHCGICSAGLYALVNGDIVEGDS
    Newman          MNPIVEFCLSNMAKGGDYVFNQLENDPDVDVLEYGCLTHCGICSAGLYALVNGDIVEGDS
    USA300_FPR3757  MNPIVEFCLSNMAKGGDYVFNQLENDPDVDVLEYGCLTHCGICSAGLYALVNGDIVEGDS
                    ************************************************************

    COL             PEELLQNIYAHIKETWIF
    N315            PEELLQNIYAHIKETWIF
    NCTC8325        PEELLQNIYAHIKETWIF
    Newman          PEELLQNIYAHIKETWIF
    USA300_FPR3757  PEELLQNIYAHIKETWIF
                    ******************