From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003039000
  • symbol?: sufA
  • description?: iron-sulfur cluster assembly accessory protein

      descriptions from strain specific annotations:

    • iron-sulfur cluster assembly accessory protein
    • iron binding protein from the HesB_IscA_SufA family
    • iron-sulfur cluster assembly accessory family protein
    • Iron sulfur assembly protein
    • HesB domain protein
    • HesB protein family
    • putative iron binding protein from theHesB_IscA_SufA family
  • strand?: +
  • coordinates?: 3427944..3428304
  • synteny block?: BlockID0021470
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0895
    08BA02176:
    C248_0939
    11819-97:
    MS7_0895
    71193:
    ST398NM01_0923
    ECT-R 2:
    ECTR2_796
    ED133:
    SAOV_0886
    ED98:
    SAAV_0901
    HO 5096 0412:
    SAEMRSA15_07700
    JH1:
    SaurJH1_0959
    JH9:
    SaurJH9_0940
    JKD6008:
    SAA6008_00891 (sufA)
    JKD6159:
    SAA6159_00799 (sufA)
    LGA251:
    SARLGA251_08580
    M013:
    M013TW_0859
    MRSA252:
    SAR0902
    MSHR1132:
    SAMSHR1132_07920
    MSSA476:
    SAS0810
    Mu3:
    SAHV_0935
    Mu50:
    SAV0940
    MW2:
    MW0822
    RF122:
    SAB0806
    ST398:
    SAPIG0923
    T0131:
    SAT0131_00970 (kdpD)
    TCH60:
    HMPREF0772_12307
    TW20:
    SATW20_09400
    USA300_TCH1516:
    USA300HOU_0901
    VC40:
    SAVC_03875

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MPTVILTEAAAYEVKDMLKANEMPDGYLKIKVNGGGCTGLTYGMGAEEAPGENDEVLEYF
    N315            MPTVILTEAAAYEVKDMLKANEMPDGYLKIKVNGGGCTGLTYGMGAEEAPGENDEVLEYF
    NCTC8325        MPTVILTEAAAYEVKDMLKANEMPDGYLKIKVNGGGCTGLTYGMGAEEAPGENDEVLEYF
    USA300_FPR3757  MPTVILTEAAAYEVKDMLKANEMPDGYLKIKVNGGGCTGLTYGMGAEEAPGENDEVLEYF
                    ************************************************************

    COL             GLKVLVDKKDAPVLNGTTIDFKQSLMGGGFQIDNPNAIASCGCGSSFRTAKVAGNPENC
    N315            GLKVLVDKEDAPVLNGTTIDFKQSLMGGGFQIDNPNAIASCGCGSSFRTAKVAGNPENC
    NCTC8325        GLKVLVDKKDAPVLNGTTIDFKQSLMGGGFQIDNPNAIASCGCGSSFRTAKVAGNPENC
    USA300_FPR3757  GLKVLVDKKDAPVLNGTTIDFKQSLMGGGFQIDNPNAIASCGCGSSFRTAKVAGNPENC
                    ********:**************************************************