From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003040000
  • symbol?: ndh2
  • description?: NADH dehydrogenase

      descriptions from strain specific annotations:

    • NADH dehydrogenase
    • FAD-dependent pyridine nucleotide-disulfide oxidoreductase
    • NADH dehydrogenase, putative
    • pyridine nucleotide-disulfide oxidoreductase family protein
    • putative pyridine nucleotide-disulfideoxidoreductase
    • NADH dehydrogenase-like protein
    • YumB
    • NADH dehydrogenase family
    • Pyridine oxidoreductase
  • strand?: +
  • coordinates?: 3429280..3430488
  • synteny block?: BlockID0021480
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0896
    08BA02176:
    C248_0940
    11819-97:
    MS7_0896
    71193:
    ST398NM01_0924
    ECT-R 2:
    ECTR2_797
    ED133:
    SAOV_0887
    ED98:
    SAAV_0902
    HO 5096 0412:
    SAEMRSA15_07710
    JH1:
    SaurJH1_0960
    JH9:
    SaurJH9_0941
    JKD6008:
    SAA6008_00892
    JKD6159:
    SAA6159_00800
    LGA251:
    SARLGA251_08590
    M013:
    M013TW_0860
    MRSA252:
    SAR0903
    MSHR1132:
    SAMSHR1132_07930
    MSSA476:
    SAS0811
    Mu3:
    SAHV_0936
    Mu50:
    SAV0941
    MW2:
    MW0823
    RF122:
    SAB0807
    ST398:
    SAPIG0924
    T0131:
    SAT0131_00971 (kdpE)
    TCH60:
    HMPREF0772_12306 (ndh)
    TW20:
    SATW20_09410
    USA300_TCH1516:
    USA300HOU_0902
    VC40:
    SAVC_03880

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAQDRKKVLVLGAGYAGLQTVTKLQKAISTEEAEITLINKNEYHYEATWLHEASAGTLNY
    N315            MAQDRKKVLVLGAGYAGLQTVTKLQKAISTEEAEITLINKNEYHYEATWLHEASAGTLNY
    NCTC8325        MAQDRKKVLVLGAGYAGLQTVTKLQKAISTEEAEITLINKNEYHYEATWLHEASAGTLNY
    Newman          MAQDRKKVLVLGAGYAGLQTVTKLQKAISTEEAEITLINKNEYHYEATWLHEASAGTLNY
    USA300_FPR3757  MAQDRKKVLVLGAGYAGLQTVTKLQKAISTEEAEITLINKNEYHYEATWLHEASAGTLNY
                    ************************************************************

    COL             EDVLYPVESVLKKDKVNFVQAEVTKIDRDAKKVETNQGIYDFDILVVALGFVSETFGIEG
    N315            EDVLYPVESVLKKDKVNFVQAEVTKIDRDAKKVETNQGIYDFDILVVALGFVSETFGIEG
    NCTC8325        EDVLYPVESVLKKDKVNFVQAEVTKIDRDAKKVETNQGIYDFDILVVALGFVSETFGIEG
    Newman          EDVLYPVESVLKKDKVNFVQAEVTKIDRDAKKVETNQGIYDFDILVVALGFVSETFGIEG
    USA300_FPR3757  EDVLYPVESVLKKDKVNFVQAEVTKIDRDAKKVETNQGIYDFDILVVALGFVSETFGIEG
                    ************************************************************

    COL             MKDHAFQIENVITARELSRHIEDKFANYAASKEKDDNDLSILVGGAGFTGVEFLGELTDR
    N315            MKDHAFQIENVITARELSRHIEDKFANYAASKEKDDNDLSILVGGAGFTGVEFLGELTDR
    NCTC8325        MKDHAFQIENVITARELSRHIEDKFANYAASKEKDDNDLSILVGGAGFTGVEFLGELTDR
    Newman          MKDHAFQIENVITARELSRHIEDKFANYAASKEKDDNDLSILVGGAGFTGVEFLGELTDR
    USA300_FPR3757  MKDHAFQIENVITARELSRHIEDKFANYAASKEKDDNDLSILVGGAGFTGVEFLGELTDR
                    ************************************************************

    COL             IPELCSKYGVDQNKVKITCVEAAPKMLPMFSEELVNHAVSYLEDRGVEFKIATPIVACNE
    N315            IPELCSKYGVDQNKVKITCVEAAPKMLPMFSEELVNHAVSYLEDRGVEFKIATPIVACNE
    NCTC8325        IPELCSKYGVDQNKVKITCVEAAPKMLPMFSEELVNHAVSYLEDRGVEFKIATPIVACNE
    Newman          IPELCSKYGVDQNKVKITCVEAAPKMLPMFSEELVNHAVSYLEDRGVEFKIATPIVACNE
    USA300_FPR3757  IPELCSKYGVDQNKVKITCVEAAPKMLPMFSEELVNHAVSYLEDRGVEFKIATPIVACNE
                    ************************************************************

    COL             KGFVVEVDGEKQQLNAGTSVWAAGVRGSKLMEESFEGVKRGRIVTKQDLTINGYDNIFVI
    N315            KGFVVEVDGEKQQLNAGTSVWAAGVRGSKLMEESFEGVKRGRIVTKQDLTINGYDNIFVI
    NCTC8325        KGFVVEVDGEKQQLNAGTSVWAAGVRGSKLMEESFEGVKRGRIVTKQDLTINGYDNIFVI
    Newman          KGFVVEVDGEKQQLNAGTSVWAAGVRGSKLMEESFEGVKRGRIVTKQDLTINGYDNIFVI
    USA300_FPR3757  KGFVVEVDGEKQQLNAGTSVWAAGVRGSKLMEESFEGVKRGRIVTKQDLTINGYDNIFVI
                    ************************************************************

    COL             GDCSAFIPAGEERPLPTTAQIAMQQGESVAKNIKRILNGESTEEFEYVDRGTVCSLGSHD
    N315            GDCSAFIPAGEERPLPTTAQIAMQQGESVAKNIKRILNGESTEEFEYVDRGTVCSLGSHD
    NCTC8325        GDCSAFIPAGEERPLPTTAQIAMQQGESVAKNIKRILNGESTEEFEYVDRGTVCSLGSHD
    Newman          GDCSAFIPAGEERPLPTTAQIAMQQGESVAKNIKRILNGESTEEFEYVDRGTVCSLGSHD
    USA300_FPR3757  GDCSAFIPAGEERPLPTTAQIAMQQGESVAKNIKRILNGESTEEFEYVDRGTVCSLGSHD
                    ************************************************************

    COL             GVGMVFGKPIAGKKAAFMKKVIDTRAVFKIGGIGLAFKKGKF
    N315            GVGMVFGKPIAGKKAAFMKKVIDTRAVFKIGGIGLAFKKGKF
    NCTC8325        GVGMVFGKPIAGKKAAFMKKVIDTRAVFKIGGIGLAFKKGKF
    Newman          GVGMVFGKPIAGKKAAFMKKVIDTRAVFKIGGIGLAFKKGKF
    USA300_FPR3757  GVGMVFGKPIAGKKAAFMKKVIDTRAVFKIGGIGLAFKKGKF
                    ******************************************