From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003044000
  • symbol?:
  • description?: thioesterase

      descriptions from strain specific annotations:

    • thioesterase
    • thioesterase superfamily protein
    • ComA2 family protein
    • ComA operon protein 2
    • thioesterase family protein
  • strand?: +
  • coordinates?: 3434779..3435153
  • synteny block?: BlockID0021520
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0899
    08BA02176:
    C248_0943
    11819-97:
    MS7_0899
    71193:
    ST398NM01_0927
    ECT-R 2:
    ECTR2_800
    ED133:
    SAOV_0890
    ED98:
    SAAV_0905
    HO 5096 0412:
    SAEMRSA15_07740
    JH1:
    SaurJH1_0963
    JH9:
    SaurJH9_0944
    JKD6008:
    SAA6008_00897
    JKD6159:
    SAA6159_00803
    LGA251:
    SARLGA251_08620
    M013:
    M013TW_0863
    MRSA252:
    SAR0906
    MSHR1132:
    SAMSHR1132_07960
    MSSA476:
    SAS0814
    Mu3:
    SAHV_0939
    Mu50:
    SAV0944
    MW2:
    MW0826
    RF122:
    SAB0810
    ST398:
    SAPIG0927
    T0131:
    SAT0131_00976
    TCH60:
    HMPREF0772_12303
    TW20:
    SATW20_09440
    USA300_TCH1516:
    USA300HOU_0904
    VC40:
    SAVC_03895

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTHLLETFEMSIDHQEDGLVVISMPVTDKVKQPFGYLHGGASIALGETACSLGSANLIDT
    N315            MTHLLETFEMSIDHQEDGLVVISMPVTDKVKQPFGYLHGGASIALGETACSLGSANLIDT
    NCTC8325        MTHLLETFEMSIDHQEDGLVVISMPVTDKVKQPFGYLHGGASIALGETACSLGSANLIDT
    Newman          MTHLLETFEMSIDHQEDGLVVISMPVTDKVKQPFGYLHGGASIALGETACSLGSANLIDT
    USA300_FPR3757  MTHLLETFEMSIDHQEDGLVVISMPVTDKVKQPFGYLHGGASIALGETACSLGSANLIDT
                    ************************************************************

    COL             TKFIPLGLEMNANHIHSAKDGRVTATAEIIHRGKSTHVWDIKIKNDKEQLITVMRGTVAI
    N315            TKFIPLGLEMNANHIHSAKDGRVTATAEIIHRGKSTHVWDIKIKNDKEQLITVMRGTVAI
    NCTC8325        TKFIPLGLEMNANHIHSAKDGRVTATAEIIHRGKSTHVWDIKIKNDKEQLITVMRGTVAI
    Newman          TKFIPLGLEMNANHIHSAKDGRVTATAEIIHRGKSTHVWDIKIKNDKEQLITVMRGTVAI
    USA300_FPR3757  TKFIPLGLEMNANHIHSAKDGRVTATAEIIHRGKSTHVWDIKIKNDKEQLITVMRGTVAI
                    ************************************************************

    COL             KPLK
    N315            KPLK
    NCTC8325        KPLK
    Newman          KPLK
    USA300_FPR3757  KPLK
                    ****