From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003047000
  • symbol?: mnhG
  • description?: Na+/H+ antiporter subunit G

      descriptions from strain specific annotations:

    • Na+/H+ antiporter subunit G
    • monovalent cation/H+ antiporter subunit G
    • putative monovalent cation/H+ antiporter subunit G
    • CPA3 family monovalent cation (K+ or Na+):proton (H+) antiporter-3 MnhG subunit
    • CPA3 family monovalent cation:proton (H+) antiporter-3 subunit G
    • monovalent cation/proton antiporter subunit MnhG/PhaG
    • monovalent cation antiporter-3 subunit G, MnhG
    • MrpG
    • Na(+)/H(+) antiporter subunit G1
    • Na(+) H(+) antiporter subunit G
    • Na+/H+ antiporter subunit
    • ShaG
  • strand?: -
  • coordinates?: 3438305..3438662
  • synteny block?: BlockID0021550
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0949 (mnhG)
    N315:
    SA0807 (mnhG)
    NCTC8325:
    Newman:
    NWMN_0816 (mnhG)
    USA300_FPR3757:
    04-02981:
    SA2981_0901 (mnhG)
    08BA02176:
    C248_0945 (mnhG)
    11819-97:
    MS7_0901
    71193:
    ST398NM01_0929
    ECT-R 2:
    ECTR2_802
    ED133:
    SAOV_0892c
    ED98:
    SAAV_0907 (mnhG)
    HO 5096 0412:
    SAEMRSA15_07760 (mnhG)
    JH1:
    SaurJH1_0965
    JH9:
    SaurJH9_0946
    JKD6008:
    SAA6008_00899 (mnhG)
    JKD6159:
    SAA6159_00805 (mnhG)
    LGA251:
    SARLGA251_08640 (mnhG)
    M013:
    M013TW_0865
    MRSA252:
    SAR0908 (mnhG)
    MSHR1132:
    SAMSHR1132_07980
    MSSA476:
    SAS0816
    Mu3:
    SAHV_0941 (mnhG)
    Mu50:
    SAV0946 (mnhG)
    MW2:
    MW0828 (mnhG)
    RF122:
    SAB0813c (mnhG)
    ST398:
    SAPIG0929
    T0131:
    SAT0131_00978
    TCH60:
    HMPREF0772_12301 (mnhG)
    TW20:
    SATW20_09460 (mnhG)
    USA300_TCH1516:
    USA300HOU_0906 (mnhG2)
    VC40:
    SAVC_03905

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF
    N315            MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF
    NCTC8325        MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF
    Newman          MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF
    USA300_FPR3757  MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF
                    ************************************************************

    COL             IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL
    N315            IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL
    NCTC8325        IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL
    Newman          IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL
    USA300_FPR3757  IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL
                    **********************************************************