From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003048000
  • symbol?: mnhF
  • description?: monovalent cation/H+ antiporter subunit F

      descriptions from strain specific annotations:

    • monovalent cation/H+ antiporter subunit F
    • putative monovalent cation/H+ antiporter subunit F
    • Na(+) H(+) antiporter subunit F
    • monovalent cation antiporter-3 subunit F, MnhF
    • CPA3 family monovalent cation (K+ or Na+):proton (H+) antiporter-3 MnhF subunit
    • multiple resistance and pH regulation protein F (MrpF / PhaF) family protein
    • Na+/H+ antiporter subunit
    • CPA3 family monovalent cation:proton (H+) antiporter-3 subunit F
    • Na(+)/H(+) antiporter subunit F1
    • Na(+)/H(+) antiporter subunit F (Mnh complex subunit F)
    • ShaF
  • strand?: -
  • coordinates?: 3438640..3438933
  • synteny block?: BlockID0021560
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0950 (mnhF)
    N315:
    SA0808 (mnhF)
    NCTC8325:
    Newman:
    NWMN_0817 (mnhF)
    USA300_FPR3757:
    04-02981:
    SA2981_0902 (mnhF)
    08BA02176:
    C248_0946 (mnhF)
    11819-97:
    MS7_0902 (mrpF)
    71193:
    ST398NM01_0930
    ECT-R 2:
    ECTR2_803
    ED133:
    SAOV_0893c
    ED98:
    SAAV_0908 (mnhF)
    HO 5096 0412:
    SAEMRSA15_07770 (mnhF)
    JH1:
    SaurJH1_0966
    JH9:
    SaurJH9_0947
    JKD6008:
    SAA6008_00900 (mnhF)
    JKD6159:
    SAA6159_00806 (mnhF)
    LGA251:
    SARLGA251_08650 (mnhF)
    M013:
    M013TW_0866
    MRSA252:
    SAR0909 (mnhF)
    MSHR1132:
    SAMSHR1132_07990
    MSSA476:
    SAS0817
    Mu3:
    SAHV_0942 (mnhF)
    Mu50:
    SAV0947 (mnhF)
    MW2:
    MW0829 (mnhF)
    RF122:
    SAB0814c (mnhF)
    ST398:
    SAPIG0930
    T0131:
    SAT0131_00979
    TCH60:
    HMPREF0772_12300 (mnhF)
    TW20:
    SATW20_09470 (mnhF)
    USA300_TCH1516:
    USA300HOU_0907 (mnhF2)
    VC40:
    SAVC_03910

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNHNVIIVIALIIVVISMLAMLIRVVLGPSLADRVVALDAIGLQLMAVIALFSILLNIKY
    N315            MNHNVIIVIALIIVVISMLAMLIRVVLGPSLADRVVALDAIGLQLMAVIALFSILLNIKY
    NCTC8325        MNHNVIIVIALIIVVISMLAMLIRVVLGPSLADRVVALDAIGLQLMAVIALFSILLNIKY
    Newman          MNHNVIIVIALIIVVISMLAMLIRVVLGPSLADRVVALDAIGLQLMAVIALFSILLNIKY
    USA300_FPR3757  MNHNVIIVIALIIVVISMLAMLIRVVLGPSLADRVVALDAIGLQLMAVIALFSILLNIKY
                    ************************************************************

    COL             MIVVIMMIGILAFLGTAVFSKFMDKGKVIEHDQNHTD
    N315            MIVVIMMIGILAFLGTAVFSKFMDKGKVIEHDQNHTD
    NCTC8325        MIVVIMMIGILAFLGTAVFSKFMDKGKVIEHDQNHTD
    Newman          MIVVIMMIGILAFLGTAVFSKFMDKGKVIEHDQNHTD
    USA300_FPR3757  MIVVIMMIGILAFLGTAVFSKFMDKGKVIEHDQNHTD
                    *************************************