From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003050000
  • symbol?: mnhD
  • description?: Na+/H+ antiporter subunit D

      descriptions from strain specific annotations:

    • Na+/H+ antiporter subunit D
    • monovalent cation/H+ antiporter subunit D
    • putative monovalent cation/H+ antiporter subunit D
    • CPA3 family monovalent cation (K+ or Na+):proton (H+) antiporter-3 MnhD subunit
    • CPA3 family monovalent cation:proton (H+) antiporter-3 subunit D
    • monovalent cation antiporter-3 subunit D, MnhD
    • multicomponent K+:H+antiporter family protein
    • Na(+)/H(+) antiporter subunit D
    • Na(+)/H(+) antiporter subunit D (Multiple resistance and pHhomeostasis protein D) (Mrp complex subunit D)
    • Na(+)/H(+) antiporter subunit D1
    • Na(+) H(+) antiporter subunit D
    • Na+/H+ antiporter subunit
    • ShaD
  • strand?: -
  • coordinates?: 3439414..3440910
  • synteny block?: BlockID0021580
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0952 (mnhD)
    N315:
    SA0810 (mnhD)
    NCTC8325:
    Newman:
    NWMN_0819 (mnhD)
    USA300_FPR3757:
    04-02981:
    SA2981_0904 (mnhD)
    08BA02176:
    C248_0948 (mnhD)
    11819-97:
    MS7_0904 (mrpD)
    71193:
    ST398NM01_0932
    ECT-R 2:
    ECTR2_805 (phaD)
    ED133:
    SAOV_0895c
    ED98:
    SAAV_0910 (mnhD)
    HO 5096 0412:
    SAEMRSA15_07790 (mnhD)
    JH1:
    SaurJH1_0968
    JH9:
    SaurJH9_0949
    JKD6008:
    SAA6008_00902 (mnhD)
    JKD6159:
    SAA6159_00808 (mnhD)
    LGA251:
    SARLGA251_08670 (mnhD)
    M013:
    M013TW_0868
    MRSA252:
    SAR0911 (mnhD)
    MSHR1132:
    SAMSHR1132_08010
    MSSA476:
    SAS0819
    Mu3:
    SAHV_0944 (mnhD)
    Mu50:
    SAV0949 (mnhD)
    MW2:
    MW0831 (mnhD)
    RF122:
    SAB0816c (mnhD)
    ST398:
    SAPIG0932
    T0131:
    SAT0131_00981
    TCH60:
    HMPREF0772_12298 (mnhD)
    TW20:
    SATW20_09490 (mnhD)
    USA300_TCH1516:
    USA300HOU_0909 (mnhD2)
    VC40:
    SAVC_03920

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIESNMLVLTLVIPVITAILLVFIGKRPIIKRYVALGGTLLTLVAAIINLANVVKHGPIR
    N315            MIESNMLVLTLVIPVITAILLVFIGKRPIIKRYVALGGTLLTLVAAIINLANVVKHGPIR
    NCTC8325        MIESNMLVLTLVIPVITAILLVFIGKRPIIKRYVALGGTLLTLVAAIINLANVVKHGPIR
    Newman          MIESNMLVLTLVIPVITAILLVFIGKRPIIKRYVALGGTLLTLVAAIINLANVVKHGPIR
    USA300_FPR3757  MIESNMLVLTLVIPVITAILLVFIGKRPIIKRYVALGGTLLTLVAAIINLANVVKHGPIR
                    ************************************************************

    COL             VELGSWKAPYSIVFVLDIFSALLIITSIIITAIVILYSSQTIGIERERYYYYFSVLFMLI
    N315            VELGSWKAPYSIVFVLDIFSALLIITSIIITAIVILYSYQTIGIERERYYYYFSVLFMLI
    NCTC8325        VELGSWKAPYSIVFVLDIFSALLIITSIIITAIVILYSYQTIGIERERYYYYFSVLFMLI
    Newman          VELGSWKAPYSIVFVLDIFSALLIITSIIITAIVILYSYQTIGIERERYYYYFSVLFMLI
    USA300_FPR3757  VELGSWKAPYSIVFVLDIFSALLIITSIIITAIVILYSYQTIGIERERYYYYFSVLFMLI
                    ************************************** *********************

    COL             GIIGAFTTGDIFNLFVFFEVFLMSSYFLLVIGSTKIQLQETIKYVLVNVVSSSFFVMGVA
    N315            GIIGAFTTGDIFNLFVFFEVFLMSSYFLLVIGSTKIQLQETIKYVLVNVVSSSFFVMGVA
    NCTC8325        GIIGAFTTGDIFNLFVFFEVFLMSSYFLLVIGSTKIQLQETIKYVLVNVVSSSFFVMGVA
    Newman          GIIGAFTTGDIFNLFVFFEVFLMSSYFLLVIGSTKIQLQETIKYVLVNVVSSSFFVMGVA
    USA300_FPR3757  GIIGAFTTGDIFNLFVYFEVFLMSSYFLLVIGSTKIQLQETIKYVLVNVVSSSFFVMGVA
                    ****************:*******************************************

    COL             ILYSVVGTLNLADISNKLANLSAHDSGLVNIVFILFIFVFATKAGVFPMFVWLPSAYYAP
    N315            ILYSVVGTLNLADISNKLANLSAHDSGLVNIVFILFIFVFATKAGVFPMFVWLPSAYYAP
    NCTC8325        ILYSVVGTLNLADISNKLANLSAHDSGLVNIVFILFIFVFATKAGVFPMFVWLPSAYYAP
    Newman          ILYSVVGTLNLADISNKLANLSAHDSGLVNIVFILFIFVFATKAGVFPMFVWLPSAYYAP
    USA300_FPR3757  ILYSVVGTLNLADISNKLANLSAHDSGLVNIVFILFIFVFATKAGVFPMFVWLPSAYYAP
                    ************************************************************

    COL             PIPIIAFFGALLTKVGVYAIARTLSLFFSDNVSFSHYVILFLALLTIIFGCVGAVAYANI
    N315            PIPIIAFFGALLTKVGVYAIARTLSLFFSDNVSFSHYVILFLALLTIIFGCVGAVAYANI
    NCTC8325        PIPIIAFFGALLTKVGVYAIARTLSLFFSDNVSFSHYVILFLALLTIIFGCVGAVAYANI
    Newman          PIPIIAFFGALLTKVGVYAIARTLSLFFSDNVSFSHYVILFLALLTIIFGCVGAVAYANI
    USA300_FPR3757  PIPIIAFFGALLTKVGVYAIARTLSLFFSDNVSFSHYVILFLALLTIIFGCVGAVAYANI
                    ************************************************************

    COL             KKIILYNVMIAVGVILVGVAMMTESGMIGAIYYTLHDMLVKLALFLLIGIMIKITGTADL
    N315            KKIILYNVMIAVGVILVGVAMMTESGMIGAIYYTLHDMLVKLALFLLIGIMIKITGTADL
    NCTC8325        KKIILYNVMIAVGVILVGVAMMTESGMIGAIYYTLHDMLVKLALFLLIGIMIKITGTADL
    Newman          KKIILYNVMIAVGVILVGVAMMTESGMIGAIYYTLHDMLVKLALFLLIGIMIKITGTADL
    USA300_FPR3757  KKIILYNVMIAVGVILVGVAMMTESGMIGAIYYTLHDMLVKLALFLLIGIMIKITGTADL
                    ************************************************************

    COL             RQFGGLIKRYPVLGWSFFIAALSLAGIPPLSGFYGKFFIVQSTFERGFYLSGVIVLLSSL
    N315            RQFGGLIKRYPVLGWSFFIAALSLAGIPPLSGFYGKFFIVQSTFERGFYLSGVIVLLSSL
    NCTC8325        RQFGGLIKRYPVLGWSFFIAALSLAGIPPLSGFYGKFFIVQSTFERGFYLSGVIVLLSSL
    Newman          RQFGGLIKRYPVLGWSFFIAALSLAGIPPLSGFYGKFFIVQSTFERGFYLSGVIVLLSSL
    USA300_FPR3757  RQFGGLIKRYPVLGWSFFIAALSLAGIPPLSGFYGKFFIVQSTFERGFYLSGVIVLLSSL
                    ************************************************************

    COL             VVLYSVIRIFLQGFFGQPKGYDLNNKVDVKYLTTIAIVAVVITVLYGLSADYLYPMVKAG
    N315            VVLYSVIRIFLQGFFGQPKGYDLNNKVDVKYLTTIAIVAVVITVLYGLSADYLYPMVKAG
    NCTC8325        VVLYSVIRIFLQGFFGQPKGYDLNNKVDVKYLTTIAIVAVVITVLYGLSADYLYPMVKAG
    Newman          VVLYSVIRIFLQGFFGQPKGYDLNNKVDVKYLTTIAIVAVVITVLYGLSADYLYPMVKAG
    USA300_FPR3757  VVLYSVIRIFLQGFFGQPKGYDLNNKVDVKYLTTIAIVAVVITVLYGLSADYLYPMVKAG
                    ************************************************************

    COL             AETFYNPSTYVKAVLGGK
    N315            AETFYNPSTYVKAVLGGK
    NCTC8325        AETFYNPSTYVKAVLGGK
    Newman          AETFYNPSTYVKAVLGGK
    USA300_FPR3757  AETFYNPSTYVKAVLGGK
                    ******************