From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003052000
  • symbol?: mnhB
  • description?: monovalent cation/H+ antiporter subunit B

      descriptions from strain specific annotations:

    • monovalent cation/H+ antiporter subunit B
    • putative monovalent cation/H+ antiporter subunit B
    • Na(+) H(+) antiporter subunit B
    • Na+/H+ antiporter subunit
    • Na(+)/H(+) antiporter subunit B (Multiple resistance and pHhomeostasis protein B) (Mrp complex subunit B)
    • CPA3 family monovalent cation:proton (H+) antiporter-3 subunit B
    • monovalent cation:proton antiporter family protein
    • Na(+)/H(+) antiporter subunit B1
    • ShaB
    • CPA3 family monovalent cation (K+ or Na+):proton (H+) antiporter-3 MnhB subunit
    • monovalent cation antiporter-3 subunit B, MnhB
  • strand?: -
  • coordinates?: 3441244..3441672
  • synteny block?: BlockID0021600
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0954 (mnhB)
    N315:
    SA0812 (mnhB)
    NCTC8325:
    Newman:
    NWMN_0821 (mnhB)
    USA300_FPR3757:
    04-02981:
    SA2981_0906 (mnhB)
    08BA02176:
    C248_0950 (mnhB)
    11819-97:
    MS7_0906
    71193:
    ST398NM01_0934
    ECT-R 2:
    ECTR2_807 (nha)
    ED133:
    SAOV_0897c
    ED98:
    SAAV_0912 (mnhB)
    HO 5096 0412:
    SAEMRSA15_07810 (mnhB)
    JH1:
    SaurJH1_0970
    JH9:
    SaurJH9_0951
    JKD6008:
    SAA6008_00904 (mnhB)
    JKD6159:
    SAA6159_00810 (mnhB)
    LGA251:
    SARLGA251_08690 (mnhB)
    M013:
    M013TW_0870
    MRSA252:
    SAR0913 (mnhB)
    MSHR1132:
    SAMSHR1132_08030
    MSSA476:
    SAS0821
    Mu3:
    SAHV_0946 (mnhB)
    Mu50:
    SAV0951 (mnhB)
    MW2:
    MW0833 (mnhB)
    RF122:
    SAB0818c (mnhC)
    ST398:
    SAPIG0934
    T0131:
    SAT0131_00983
    TCH60:
    HMPREF0772_12296 (mnhB)
    TW20:
    SATW20_09510 (mnhB)
    USA300_TCH1516:
    USA300HOU_0911 (mnhB2)
    VC40:
    SAVC_03930

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE
    N315            MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE
    NCTC8325        MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE
    Newman          MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE
    USA300_FPR3757  MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE
                    ************************************************************

    COL             TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD
    N315            TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD
    NCTC8325        TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD
    Newman          TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD
    USA300_FPR3757  TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD
                    ************************************************************

    COL             FGVLCAVVGTVMTIIISIGENE
    N315            FGVLCAVVGTVMTIIISIGENE
    NCTC8325        FGVLCAVVGTVMTIIISIGENE
    Newman          FGVLCAVVGTVMTIIISIGENE
    USA300_FPR3757  FGVLCAVVGTVMTIIISIGENE
                    **********************