From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003053000
  • symbol?: mnhA
  • description?: monovalent cation/H+ antiporter subunit A

      descriptions from strain specific annotations:

    • monovalent cation/H+ antiporter subunit A
    • Na+/H+ antiporter subunit A
    • CPA3 family monovalent cation (K+ or Na+):proton (H+) antiporter-3 MnhA subunit
    • monovalent cation:proton antiporter family protein
    • monovalent cation antiporter-3 subunit A, MnhA
    • Na(+)/H(+) antiporter subunit A (Multiple resistance and pHhomeostasis protein A) (Mrp complex subunit A)
    • Na(+)/H(+) antiporter subunit A1
    • Na(+) H(+) antiporter subunit A
    • Na+/H+ antiporter subunit
    • ShaA
  • strand?: -
  • coordinates?: 3441665..3444070
  • synteny block?: BlockID0021610
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0955 (mnhA)
    N315:
    SA0813 (mnhA)
    NCTC8325:
    Newman:
    NWMN_0822 (mnhA)
    USA300_FPR3757:
    04-02981:
    SA2981_0907 (mnhA)
    08BA02176:
    C248_0951 (mnhA)
    11819-97:
    MS7_0907 (mnhA1)
    71193:
    ST398NM01_0935
    ECT-R 2:
    ECTR2_808 (CPA3)
    ED133:
    SAOV_0898c
    ED98:
    SAAV_0913 (mnhA)
    HO 5096 0412:
    SAEMRSA15_07820 (mnhA)
    JH1:
    SaurJH1_0971
    JH9:
    SaurJH9_0952
    JKD6008:
    SAA6008_00905 (mnhA)
    JKD6159:
    SAA6159_00811 (mnhA)
    LGA251:
    SARLGA251_08700 (mnhA)
    M013:
    M013TW_0871
    MRSA252:
    SAR0914 (mnhA)
    MSHR1132:
    SAMSHR1132_08040
    MSSA476:
    SAS0822
    Mu3:
    SAHV_0947 (mnhA)
    Mu50:
    SAV0952 (mnhA)
    MW2:
    MW0834 (mnhA)
    RF122:
    SAB0819c (mnhA)
    ST398:
    SAPIG0935
    T0131:
    SAT0131_00984
    TCH60:
    HMPREF0772_12295 (mnhA)
    TW20:
    SATW20_09520 (mnhA)
    USA300_TCH1516:
    USA300HOU_0912 (mnhA2)
    VC40:
    SAVC_03935

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSLLHIAVILPLIFALIIPILYRFFKRIHLGWFVLPVPIVIFIYMLTLIKTTMSGNTVMK
    N315            MSLLHIAVILPLIFALIIPILYRFFKRIHLGWFVLPVPIVIFIYMLTLIKTTMSGNTVMK
    NCTC8325        MSLLHIAVILPLIFALIIPILYRFFKRIHLGWFVLPVPIVIFIYMLTLIKTTMSGNTVMK
    Newman          MSLLHIAVILPLIFALIIPILYRFFKRIHLGWFVLPVPIVIFIYMLTLIKTTMSGNTVMK
    USA300_FPR3757  MSLLHIAVILPLIFALIIPILYRFFKRIHLGWFVLPVPIVIFIYMLTLIKTTMSGNTVMK
                    ************************************************************

    COL             TLNWMPHFGMNFDLYLDGLGLLFSLLISGIGSLVVLYSIGYLSKSEQLGNFYCYLLLFMG
    N315            TLNWMPHFGMNFDLYLDGLGLLFSLLISGIGSLVVLYSIGYLSKSEQLGNFYCYLLLFMG
    NCTC8325        TLNWMPHFGMNFDLYLDGLGLLFSLLISGIGSLVVLYSIGYLSKSEQLGNFYCYLLLFMG
    Newman          TLNWMPHFGMNFDLYLDGLGLLFSLLISGIGSLVVLYSIGYLSKSEQLGNFYCYLLLFMG
    USA300_FPR3757  TLNWMPHFGMNFDLYLDGLGLLFSLLISGIGSLVVLYSIGYLSKSEQLGNFYCYLLLFMG
                    ************************************************************

    COL             AMLGVVLSDNVIILYLFWELTSFSSFLLISFWRERQASIYGAQKSLIITVFGGLSLLGGI
    N315            AMLGVVLSDNVIILYLFWELTSFSSFLLISFWRERQASIYGAQKSLIITVFGGLSLLGGI
    NCTC8325        AMLGVVLSDNVIILYLFWELTSFSSFLLISFWRERQASIYGAQKSLIITVFGGLSLLGGI
    Newman          AMLGVVLSDNVIILYLFWELTSFSSFLLISFWRERQASIYGAQKSLIITVFGGLSLLGGI
    USA300_FPR3757  AMLGVVLSDNVIILYLFWELTSFSSFLLISFWRERQASIYGAQKSLIITVFGGLSLLGGI
                    ************************************************************

    COL             ILLAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIMIGAFTKSAQFPFYIWLPDAMEAPT
    N315            ILLAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIMIGAFTKSAQFPFYIWLPDAMEAPT
    NCTC8325        ILLAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIMIGAFTKSAQFPFYIWLPDAMEAPT
    Newman          ILLAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIMIGAFTKSAQFPFYIWLPDAMEAPT
    USA300_FPR3757  ILLAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIMIGAFTKSAQFPFYIWLPDAMEAPT
                    ************************************************************

    COL             PVSAYLHSATMVKAGLYLIARMTPIFAASQGWVWTVTLVGLITLFWASLNATKQQDLKGI
    N315            PVSAYLHSATMVKAGLYLIARMTPIFAASQGWVWTVTLVGLITLFWASLNATKQQDLKGI
    NCTC8325        PVSAYLHSATMVKAGLYLIARMTPIFAASQGWVWTVTLVGLITLFWASLNATKQQDLKGI
    Newman          PVSAYLHSATMVKAGLYLIARMTPIFAASQGWVWTVTLVGLITLFWASLNATKQQDLKGI
    USA300_FPR3757  PVSAYLHSATMVKAGLYLIARMTPIFAASQGWVWTVTLVGLITLFWASLNATKQQDLKGI
                    ************************************************************

    COL             LAFSTVSQLGMIMAMLGIGAISYHYQGDDSKIYAAAFTAAIFHLINHATFKGALFMITGA
    N315            LAFSTVSQLGMIMAMLGIGAISYHYQGDDSKIYAAAFTAAIFHLINHATFKGALFMITGA
    NCTC8325        LAFSTVSQLGMIMAMLGIGAISYHYQGDDSKIYAAAFTAAIFHLINHATFKGALFMITGA
    Newman          LAFSTVSQLGMIMAMLGIGAISYHYQGDDSKIYAAAFTAAIFHLINHATFKGALFMITGA
    USA300_FPR3757  LAFSTVSQLGMIMAMLGIGAISYHYQGDDSKIYAAAFTAAIFHLINHATFKGALFMITGA
                    ************************************************************

    COL             VDHSTGTRDVKKLGGLLTIMPISFTITVITALSMAGVPPFNGFLSKESFLETTFTASQAN
    N315            VDHSTGTRDVKKLGGLLTIMPISFTITVITALSMAGVPPFNGFLSKESFLETTFTASQAN
    NCTC8325        VDHSTGTRDVKKLGGLLTIMPISFTITVITALSMAGVPPFNGFLSKESFLETTFTASQAN
    Newman          VDHSTGTRDVKKLGGLLTIMPISFTITVITALSMAGVPPFNGFLSKESFLETTFTASQAN
    USA300_FPR3757  VDHSTGTRDVKKLGGLLTIMPISFTITVITALSMAGVPPFNGFLSKESFLETTFTASQAN
                    ************************************************************

    COL             LFSVDTLGYLFPIIGIVGSVFTFVYSIKFIMHIFFGQYKPEQLPKKAHEVSILMLLSPAI
    N315            LFSVDTLGYLFPIIGIVGSVFTFVYSIKFIMHIFFGQYKPEQLPKKAHEVSILMLLSPAI
    NCTC8325        LFSVDTLGYLFPIIGIVGSVFTFVYSIKFIMHIFFGQYKPEQLPKKAHEVSILMLLSPAI
    Newman          LFSVDTLGYLFPIIGIVGSVFTFVYSIKFIMHIFFGQYKPEQLPKKAHEVSILMLLSPAI
    USA300_FPR3757  LFSVDTLGYLFPIIGIVGSVFTFVYSIKFIMHIFFGQYKPEQLPKKAHEVSILMLLSPAI
                    ************************************************************

    COL             LATLVIVFGLFPGILTNSIIEPATSSINHTVIDDVEFHMFHGLTPAFLSTLVIYILGILL
    N315            LATLVIVLGLFPGILTNSIIEPATSSINHTVIDDVEFHMFHGLTPAFLSTLVIYILGILL
    NCTC8325        LATLVIVFGLFPGILTNSIIEPATSSINHTVIDDVEFHMFHGLTPAFLSTLVIYILGILL
    Newman          LATLVIVFGLFPGILTNSIIEPATSSINHTVIDDVEFHMFHGLTPAFLSTLVIYILGILL
    USA300_FPR3757  LATLVIVFGLFPGILTNSIIEPATSSINHTVIDDVEFHMFHGLTPAFLSTLVIYILGILL
                    *******:****************************************************

    COL             IVTFSYWVKLLQRQPGKLTFNYWYNRSANVIPNYSEKMTNSYVTDYSRNNLVIIFGALIL
    N315            IVTFSYWVKLLQRQPGKLTFNYWYNRSANVIPNYSEKMTNSYVTDYSRNNLVIIFGALIL
    NCTC8325        IVTFSYWVKLLQRQPGKLTFNYWYNRSANVIPNYSEKMTNSYVTDYSRNNLVIIFGALIL
    Newman          IVTFSYWVKLLQRQPGKLTFNYWYNRSANVIPNYSEKMTNSYVTDYSRNNLVIIFGALIL
    USA300_FPR3757  IVTFSYWVKLLQRQPGKLTFNYWYNRSANVIPNYSEKMTNSYVTDYSRNNLVIIFGALIL
                    ************************************************************

    COL             LTFVTIFSVPFNINFKDVSPIRIFEVCIVILLLSAAFLILFAKSRLFSIIMLSAVGYAVS
    N315            LTFVTIFSVPFNINFKDVSPIRIFEVCIVILLLSAAFLILFAKSRLFSIIMLSAVGYAVS
    NCTC8325        LTFVTIFSVPFNINFKDVSPIRIFEVCIVILLLSAAFLILFAKSRLFSIIMLSAVGYAVS
    Newman          LTFVTIFSVPFNINFKDVSPIRIFEVCIVILLLSAAFLILFAKSRLFSIIMLSAVGYAVS
    USA300_FPR3757  LTFVTIFSVPFNINFKDVSPIRIFEVCIVILLLSAAFLILFAKSRLFSIIMLSAVGYAVS
                    ************************************************************

    COL             VLFIFFKAPDLALTQFVVESISTALFLLCFYHLPNLNRYNEKRSFQLTNALIAGGVGLSV
    N315            VLFIFFKAPDLALTQFVVESISTALFLLCFYHLPNLNRYNEKRSFQLTNALIAGGVGLSV
    NCTC8325        VLFIFFKAPDLALTQFVVESISTALFLLCFYHLPNLNRYNEKRSFQLTNALIAGGVGLSV
    Newman          VLFIFFKAPDLALTQFVVESISTALFLLCFYHLPNLNRYNEKRSFQLTNALIAGGVGLSV
    USA300_FPR3757  VLFIFFKAPDLALTQFVVESISTALFLLCFYHLPNLNRYNEKRSFQLTNALIAGGVGLSV
                    ************************************************************

    COL             IIIGLIAYGNRHFESISKFYQEHVYDLAHGKNMVNVILVDFRGMDTLFESSVLGIAGLAV
    N315            IIIGLIAYGNRHFESISKFYQEHVYDLAHGKNMVNVILVDFRGMDTLFESSVLGIAGLAV
    NCTC8325        IIIGLIAYGNRHFESISKFYQEHVYDLAHGKNMVNVILVDFRGMDTLFESSVLGIAGLAV
    Newman          IIIGLIAYGNRHFESISKFYQEHVYDLAHGKNMVNVILVDFRGMDTLFESSVLGIAGLAV
    USA300_FPR3757  IIIGLIAYGNRHFESISKFYQEHVYDLAHGKNMVNVILVDFRGMDTLFESSVLGIAGLAV
                    ************************************************************

    COL             YTMIKLRKKRQTQGNEVKNHE
    N315            YTMIKLRKKRQTQGNEVKNHE
    NCTC8325        YTMIKLRKKRQTQGNEVKNHE
    Newman          YTMIKLRKKRQTQGNEVKNHE
    USA300_FPR3757  YTMIKLRKKRQTQGNEVKNHE
                    *********************