From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003054000
  • symbol?: kapB
  • description?: kinase

      descriptions from strain specific annotations:

    • kinase
    • kinase-associated protein B
    • kinase associated B family protein
    • kinase associated protein B family protein
  • strand?: -
  • coordinates?: 3444201..3444584
  • synteny block?: BlockID0021620
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0956 (kapB)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0908
    08BA02176:
    C248_0952
    11819-97:
    MS7_0908
    71193:
    ST398NM01_0936
    ECT-R 2:
    ECTR2_809
    ED133:
    SAOV_0899c
    ED98:
    SAAV_0914 (kapB)
    HO 5096 0412:
    SAEMRSA15_07830
    JH1:
    SaurJH1_0972
    JH9:
    SaurJH9_0953
    JKD6008:
    SAA6008_00906 (kapB)
    JKD6159:
    SAA6159_00812 (kapB)
    LGA251:
    SARLGA251_08710
    M013:
    M013TW_0872
    MRSA252:
    SAR0915
    MSHR1132:
    SAMSHR1132_08050
    MSSA476:
    SAS0823
    Mu3:
    SAHV_0948
    Mu50:
    SAV0953
    MW2:
    MW0835
    RF122:
    SAB0820c
    ST398:
    SAPIG0936
    T0131:
    SAT0131_00985
    TCH60:
    HMPREF0772_12294 (kapB)
    TW20:
    SATW20_09530
    USA300_TCH1516:
    USA300HOU_0913 (kapB)
    VC40:
    SAVC_03940

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKLYRFSHKTGSYGVTIVEENGDDVLVKVEQVIKHPKQGDLHNPTETEGVFFHDRKALSH
    N315            MKLYRFSHKTGSYGVTIVEENGDDVLVKVEQVIKHPKQGDLHNPTETEGVFFHERKALSH
    NCTC8325        MKLYRFSHKTGSYGVTIVEENGDDVLVKVEQVIKHPKQGDLHNPTETEGVFFHDRKALSH
    Newman          MKLYRFSHKTGSYGVTIVEENGDDVLVKVEQVIKHPKQGDLHNPTETEGVFFHDRKALSH
    USA300_FPR3757  MKLYRFSHKTGSYGVTIVEENGDDVLVKVEQVIKHPKQGDLHNPTETEGVFFHDRKALSH
                    *****************************************************:******

    COL             FEKRYTKRSQLRDFNVDVLRYEDSLQQAITDLETKLKAQQTKHAEMSLASLARLKEDYSL
    N315            FEKRYTKRSQLRDFNVDVLRYEDSLQQAITDLETKLKAQQTKHAEMSLASLARLKEDYSL
    NCTC8325        FEKRYTKRSQLRDFNVDVLRYEDSLQQAITDLETKLKAQQTKHAEMSLASLARLKEDYSL
    Newman          FEKRYTKRSQLRDFNVDVLRYEDSLQQAITDLETKLKAQQTKHAEMSLASLARLKEDYSL
    USA300_FPR3757  FEKRYTKRSQLRDFNVDVLRYEDSLQQAITDLETKLKAQQTKHAEMSLASLARLKEDYSL
                    ************************************************************

    COL             QYKENFK
    N315            QYKENFK
    NCTC8325        QYKENFK
    Newman          QYKENFK
    USA300_FPR3757  QYKENFK
                    *******