From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003109000
  • symbol?: sufT
  • description?: N-6 adenine-specific DNA methylase YitW

      descriptions from strain specific annotations:

    • N-6 adenine-specific DNA methylase YitW
    • PaaD-like protein involved in Fe-S cluster assembly
    • putative metal-sulfur cluster biosynthetic enzyme, PaaD
  • strand?: +
  • coordinates?: 3495082..3495399
  • synteny block?: BlockID0022020
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0927 (paaD)
    08BA02176:
    C248_0998
    11819-97:
    MS7_0928
    71193:
    ST398NM01_0972
    ECT-R 2:
    ECTR2_828
    ED133:
    SAOV_0919
    ED98:
    SAAV_0933
    HO 5096 0412:
    SAEMRSA15_08020
    JH1:
    SaurJH1_0991
    JH9:
    SaurJH9_0972
    JKD6008:
    SAA6008_00925 (paaD)
    JKD6159:
    SAA6159_00832 (paaD)
    LGA251:
    SARLGA251_08900
    M013:
    M013TW_0891
    MRSA252:
    SAR0935
    MSHR1132:
    SAMSHR1132_08240
    MSSA476:
    SAS0842
    Mu3:
    SAHV_0967
    Mu50:
    SAV0972
    MW2:
    MW0854
    RF122:
    SAB0841
    ST398:
    SAPIG0972
    T0131:
    SAT0131_01005 (murA)
    TCH60:
    HMPREF0772_12273 (yitW)
    TW20:
    SATW20_09720
    USA300_TCH1516:
    USA300HOU_0931
    VC40:
    SAVC_04035

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---MEEALKDSILGALEMVIDPELGIDIVNLGLVYKVNVDDEGVCTVDMTLTSMGCPMGP
    N315            ---MEEALKDSILGALEMVIDPELGIDIVNLGLVYKVNVDDEGVCTVDMTLTSMGCPMGP
    NCTC8325        -----------------MVIDPELGIDIVNLGLVYKVNVDDEGVCTVDMTLTSMGCPMGP
    Newman          MIWMEEALKDSILGALEMVIDPELGIDIVNLGLVYKVNVDDEGVCTVDMTLTSMGCPMGP
    USA300_FPR3757  -----------------MVIDPELGIDIVNLGLVYKVNVDDEGVCTVDMTLTSMGCPMGP
                                     *******************************************

    COL             QIIDQVKTVLAEIPEIQDTEVNIVWSPPWTKDMMSRYAKIALGVS
    N315            QIIDQVKTVLAEIPEIQDTEVNIVWSPPWTKDMMSRYAKIALGVS
    NCTC8325        QIIDQVKTVLAEIPEIQDTEVNIVWSPPWTKDMMSRYAKIALGVS
    Newman          QIIDQVKTVLAEIPEIQDTEVNIVWSPPWTKDMMSRYAKIALGVS
    USA300_FPR3757  QIIDQVKTVLAEIPEIQDTEVNIVWSPPWTKDMMSRYAKIALGVS
                    *********************************************