From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003111000
  • symbol?:
  • description?: lipopolysaccharide modification acyltransferase

      descriptions from strain specific annotations:

    • lipopolysaccharide modification acyltransferase
    • acyltransferase 3
    • acyltransferase family protein
    • O-acetyltransferase OatA
    • Putative O-acetyltransferase
    • pseudogene
  • strand?: +
  • coordinates?: 3496225..3498049
  • synteny block?: BlockID0022040
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0844 (clpB)
    USA300_FPR3757:
    04-02981:
    SA2981_0929
    08BA02176:
    C248_1000
    11819-97:
    MS7_0929
    71193:
    ST398NM01_0973
    ECT-R 2:
    ECTR2_829
    ED133:
    SAOV_0920
    ED98:
    SAAV_0934
    HO 5096 0412:
    SAEMRSA15_08030
    JH1:
    SaurJH1_0992
    JH9:
    SaurJH9_0973
    JKD6008:
    SAA6008_00926
    JKD6159:
    SAA6159_00833
    LGA251:
    SARLGA251_08910
    M013:
    M013TW_0892
    MRSA252:
    SAR0937
    MSHR1132:
    SAMSHR1132_08250
    MSSA476:
    SAS0844
    Mu3:
    SAHV_0969
    Mu50:
    SAV0974
    MW2:
    MW0856
    RF122:
    SAB0842
    ST398:
    SAPIG0973
    T0131:
    SAT0131_01006
    TCH60:
    HMPREF0772_12272
    TW20:
    SATW20_09730
    USA300_TCH1516:
    USA300HOU_0932
    VC40:
    SAVC_04040

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKTKGFTKYKKMRYIPGLDGLRAIAVLGIIIYHLNKQWLTGGFLGVDTFFVISGYLITS
    N315            MNKTKGFTKYKKMRYMPGLDGLRAIAVLGIIIYHLNKQWLTGGFLGVDTFFVISGYLITS
    NCTC8325        MNKTKGFTKYKKMRYIPGLDGLRAIAVLGIIIYHLNKQWLTGGFLGVDTFFVISGYLITS
    Newman          MNKTKGFTKYKKMRYIPGLDGLRAIAVLGIIIYHLNKQWLTGGFLGVDTFFVISGYLITS
    USA300_FPR3757  MNKTKGFTKYKKMRYIPGLDGLRAIAVLGIIIYHLNKQWLTGGFLGVDTFFVISGYLITS
                    ***************:********************************************

    COL             LLLKEYDDTGIIKLKSFWIRRLKRLLPAVIVLLMVVGTATLLLKSDNIIRVKHDIIAAIF
    N315            LLLKEYDDTGIIKLKSFWIRRLKRLLPAVIVLLMVVGTATLLLKSDNIIRVKHDIIAAIF
    NCTC8325        LLLKEYDDTGIIKLKSFWIRRLKRLLPAVIVLLMVVGTATLLLKSDNIIRVKHDIIAAIF
    Newman          LLLKEYDDTGIIKLKSFWIRRLKRLLPAVIVLLMVVGTATLLLKSDNIIRVKHDIIAAIF
    USA300_FPR3757  LLLKEYDDTGIIKLKSFWIRRLKRLLPAVIVLLMVVGTATLLLKSDNIIRVKHDIIAAIF
                    ************************************************************

    COL             YVSNWWYIAKDVNYFEQFSFMPLKHLWSLAIEEQFYIFFPVILVTLLLTIKKRYKIGFIF
    N315            YVSNWWYIAKDVNYFEQFSFMPLKHLWSLAIEEQFYIFFPVILVTLLLTIKKRYKIGFIF
    NCTC8325        YVSNWWYIAKDVNYFEQFSFMPLKHLWSLAIEEQFYIFFPVILVTLLLTIKKRYKIGFIF
    Newman          YVSNWWYIAKDVNYFEQFSFMPLKHLWSLAIEEQFYIFFPVILVTLLLTIKKRYKIGFIF
    USA300_FPR3757  YVSNWWYIAKDVNYFEQFSFMPLKHLWSLAIEEQFYIFFPVILVTLLLTIKKRYKIGFIF
                    ************************************************************

    COL             WGVSIISLGLMMFIYSINGDHSRVYFGTDTRLQTLLLGVILAFLWPPFKLKNDPPKVVKY
    N315            WGVSIISLGLMMFIYSINGDHSRVYFGTDTRLQTLLLGVILAFLWPPFKLKNDPPKVVKY
    NCTC8325        WGVSIISLGLMMFIYSINGDHSRVYFGTDTRLQTLLLGVILAFLWPPFKLKNDPPKVVKY
    Newman          WGVSIISLGLMMFIYSINGDHSRVYFGTDTRLQTLLLGVILAFLWPPFKLKNDPPKVVKY
    USA300_FPR3757  WGVSIISLGLMMFIYSINGDHSRVYFGTDTRLQTLLLGVILAFLWPPFKLKNDPPKVVKY
                    ************************************************************

    COL             VIDSIGSLSFIVLILLFFIINDETNWIYDGGFYLISILTLFIIASVVHPSTWIAKIFSNP
    N315            VIDSIGSLSFIVLILLFFIINDETNWIYDGGFYLISILTLFIIASVVHPSTWIAKIFSNP
    NCTC8325        VIDSIGSLSFIVLILLFFIINDETNWIYDGGFYLISILTLFIIASVVHPSTWIAKIFSNP
    Newman          VIDSIGSLSFIVLILLFFIINDETNWIYDGGFYLISILTLFIIASVVHPSTWIAKIFSNP
    USA300_FPR3757  VIDSIGSLSFIVLILLFFIINDETNWIYDGGFYLISILTLFIIASVVHPSTWIAKIFSNP
                    ************************************************************

    COL             VLVFIGKRSYSLYLWHFAVISFVHSYYVDGQIPVYVYFIDISLTIIFAELSYRFIETPFR
    N315            VLVFIGKRSYSLYLWHFAVISFVHSYYVDGQIPVYVYFIDISLTIIFAELSYRFIETPFR
    NCTC8325        VLVFIGKRSYSLYLWHFAVISFVHSYYVDGQIPVYVYFIDISLTIIFAELSYRFIETPFR
    Newman          VLVFIGKRSYSLYLWHFAVISFVHSYYVDGQIPVYVYFIDISLTIIFAELSYRFIETPFR
    USA300_FPR3757  VLVFIGKRSYSLYLWHFAVISFVHSYYVDGQIPVYVYFIDISLTIIFAELSYRFIETPFR
                    ************************************************************

    COL             KEGIKALNWRPSYIPQFIRMAIVVTLLIPFMLILVGAFNKYGKDIIGEKANSFDTTIEDN
    N315            KEGIKALNWRPSYIPQFIRMAIVVTLLIPFMLILVGAFNKYGKDIIGEKANSFDTTIEDN
    NCTC8325        KEGIKALNWRPSYIPQFIRMAIVVTLLIPFMLILVGAFNKYGKDIIGEKANSFDTTIEDN
    Newman          KEGIKALNWRPSYIPQFIRMAIVVTLLIPFMLILVGAFNKYGKDIIGEKANSFDTTIEDN
    USA300_FPR3757  KEGIKALNWRPSYIPQFIRMAIVVTLLIPFMLILVGAFNKYGKDIIGEKANSFDTTIEDN
                    ************************************************************

    COL             YLMRIAPIDNIHIDGLVSEKKKESSDVYNNIKPLLIGDSVMVDIGESFKSSVPKSRIDGK
    N315            YLMRIAPIDNIHIDGLVSEKKKESSDVYNNIKPLLIGDSVMVDIGESFKSSVPKSRIDGK
    NCTC8325        YLMRIAPIDNIHIDGLVSEKKKESSDVYNNIKPLLIGDSVMVDIGESFKSSVPKSRIDGK
    Newman          YLMRIAPIDNIHIDGLVSEKKKESSDVYNNIKPLLIGDSVMVDIGESFKSSVPKSRIDGK
    USA300_FPR3757  YLMRIAPIDNIHIDGLVSEKKKESSDVYNNIKPLLIGDSVMVDIGESFKSSVPKSRIDGK
                    ************************************************************

    COL             VGRQLYQTLPLVKANYSQYKKSSDQVVLELGTNGDFTVKQLDDLLNQFGKAKIYLVNTRV
    N315            VGRQLYQTLPLVKANYSQYKKSSDQVVLELGTNGDFTVKQLDDLLNQFGKAKIYLVNTRV
    NCTC8325        VGRQLYQTLPLVKANYSQYKKSSDQVVLELGTNGDFTVKQLDDLLNQFGKAKIYLVNTRV
    Newman          VGRQLYQTLPLVKANYSQYKKSSDQVVLELGTNGDFTVKQLDDLLNQFGKAKIYLVNTRV
    USA300_FPR3757  VGRQLYQTLPLVKANYSQYKKSSDQVVLELGTNGDFTVKQLDDLLNQFGKAKIYLVNTRV
                    ************************************************************

    COL             PRIYEANVNRLLADAAKRKSNVTLIDWYKRSQGHSEYFAPDGVHLEYKGVLALKDEILKA
    N315            PRIYEANVNRLLADAAKRKSNVTLIDWNKRSQGHSEYFAPDGVHLEYKGVLALKDEILKA
    NCTC8325        PRIYEANVNRLLADAAKRKSNVTLIDWYKRSQGHSEYFAPDGVHLEYKGVLALKDEILKA
    Newman          PRIYEANVNRLLADAAKRKSNVTLIDWYKRSQGHSEYFAPDGVHLEYKGVLALKDEILKA
    USA300_FPR3757  PRIYEANVNRLLADAAKRKSNVTLIDWYKRSQGHSEYFAPDGVHLEYKGVLALKDEILKA
                    *************************** ********************************

    COL             LKKK
    N315            LKKK
    NCTC8325        LKKK
    Newman          LKKK
    USA300_FPR3757  LKKK
                    ****