From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003119000
  • symbol?:
  • description?: Sua5/YciO/YrdC/YwlC family protein

      descriptions from strain specific annotations:

    • Sua5/YciO/YrdC/YwlC family protein
    • pseudogene
    • SUA5/yciO/yrdC, N-terminal domain protein
    • SUA5/yciO/yrdC domain-containing protein
    • SUA5 protein
    • Sua5 YciO YrdC YwlC family protein
  • strand?: +
  • coordinates?: 3503067..3503708
  • synteny block?: BlockID0022110
  • occurrence?: in 81% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0933
    08BA02176:
    11819-97:
    MS7_0933
    71193:
    ECT-R 2:
    ECTR2_833
    ED133:
    SAOV_0924
    ED98:
    SAAV_0939
    HO 5096 0412:
    SAEMRSA15_08070
    JH1:
    SaurJH1_0996
    JH9:
    SaurJH9_0977
    JKD6008:
    SAA6008_00931
    JKD6159:
    LGA251:
    SARLGA251_08950
    M013:
    M013TW_0898
    MRSA252:
    SAR0941
    MSHR1132:
    MSSA476:
    SAS0848
    Mu3:
    SAHV_0973
    Mu50:
    SAV0978
    MW2:
    MW0860
    RF122:
    ST398:
    T0131:
    SAT0131_01011 (atpG)
    TCH60:
    HMPREF0772_12267
    TW20:
    SATW20_09770
    USA300_TCH1516:
    USA300HOU_0936
    VC40:
    SAVC_04060

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEILNDSVKSFEKLYLQLQDGFPVIVPTDTNYNLCSLPNNDLCIDKIFEYKKRSKDKPLS
    N315            MEILNDSVKSFEKLYLQLQDGFPVIVPTDTNYNLCSLPNNDLCIDKIFEYKKRSKDKPLS
    NCTC8325        MEILNDSVKSFEKLYLQLQDGFPVIVPTDTNYNLCSLPNNDLCIDKIFEYKKRSKDKPLS
    Newman          MEILNDSVKSFEKLYLQLQDGFPVIVPTDTNYNLCSLPNNDLCIDKIFEYKKRSKDKPLS
    USA300_FPR3757  MEILNDSVKSFEKLYLQLQDGFPVIVPTDTNYNLCSLPNNDLCIDKIFEYKKRSKDKPLS
                    ************************************************************

    COL             LFIDKPEDWKLYGDNQNTEIVDKLVEIFWPGPLNIILKNKTSYNYMLNNSDSIAIGCVQN
    N315            LFIDKPEDWKLYGDNQNTEIVDKLVEIFWPGPLNIILKNKTSYNYMLNNSDSIAIGCVQN
    NCTC8325        LFIDKPEDWKLYGDNQNTEIVDKLVEIFWPGPLNIILKNKTSYNYMLNNSDSIAIGCVQN
    Newman          LFIDKPEDWKLYGDNQNTEIVDKLVEIFWPGPLNIILKNKTSYNYMLNNSDSIAIGCVQN
    USA300_FPR3757  LFIDKPEDWKLYGDNQNTEIVDKLVEIFWPGPLNIILKNKTSYNYMLNNSDSIAIGCVQN
                    ************************************************************

    COL             KTMRRFISYINSPIAITSANISGTADDILITENEAIKHMGENVRYMLRSQNKTNYKTSST
    N315            KTMRRFISYINSPIAITSANISGTADDILITENEAIKHMGENVRYMLRSQNKTNYKTSST
    NCTC8325        KTMRRFISYINSPIAITSANISGTADDILITENEAIKHMGENVRYMLRSQNKTNYKTSST
    Newman          KTMRRFISYINSPIAITSANISGTADDILITENEAIKHMGENVRYMLRSQNKTNYKTSST
    USA300_FPR3757  KTMRRFISYINSPIAITSANISGTADDILITENEAIKHMGENVRYMLRSQNKTNYKTSST
                    ************************************************************

    COL             IIKVTDNKIELLREGDIKFEEIKERLGTGIIYE
    N315            IIKVTDNKIELLREGDIKFEEIKERLGTGIIYE
    NCTC8325        IIKVTDNKIELLREGDIKFEEIKERLGTGIIYE
    Newman          IIKVTDNKIELLREGDIKFEEIKERLGTGIIYE
    USA300_FPR3757  IIKVTDNKIELLREGDIKFEEIKERLGTGIIYE
                    *********************************