From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003126000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 3509668..3509853
  • synteny block?: BlockID0022180
  • occurrence?: in 88% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0937
    08BA02176:
    11819-97:
    MS7_0937
    71193:
    ST398NM01_0978
    ECT-R 2:
    ECTR2_837
    ED133:
    ED98:
    SAAV_0943
    HO 5096 0412:
    SAEMRSA15_08110
    JH1:
    SaurJH1_1000
    JH9:
    SaurJH9_0981
    JKD6008:
    SAA6008_00935
    JKD6159:
    SAA6159_00838
    LGA251:
    SARLGA251_08990
    M013:
    M013TW_0904
    MRSA252:
    SAR0945
    MSHR1132:
    SAMSHR1132_08300
    MSSA476:
    SAS0852
    Mu3:
    SAHV_0977
    Mu50:
    SAV0982
    MW2:
    MW0864
    RF122:
    ST398:
    SAPIG0978
    T0131:
    SAT0131_01015
    TCH60:
    HMPREF0772_12263
    TW20:
    SATW20_09810
    USA300_TCH1516:
    USA300HOU_0940
    VC40:
    SAVC_04080

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKHLVTFFWALLLMQMVNFVLNSLVGGDSLNVVNPIIMAVLFTIFTAIFAAVIKPPKDSS
    N315            MKHLVTFFWALLLMQMVNFVLNSLVGGDSLNVVNPIIMAVLFTIFTAIFAAVIKPPKDSS
    NCTC8325        MKHLVTFFWALLLMQMVNFVLNSLVGGDSLNVVNPIIMAVLFTIFTAIFAAVIKPPKDSS
    USA300_FPR3757  MKHLVTFFWALLLMQMVNFVLNSLVGGDSLNVVNPIIMAVLFTIFTAIFAAVIKPPKDSS
                    ************************************************************

    COL             Q
    N315            Q
    NCTC8325        Q
    USA300_FPR3757  Q
                    *