From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003127000
  • symbol?: fabH
  • description?: 3-oxoacyl-ACP synthase

      descriptions from strain specific annotations:

    • 3-oxoacyl-ACP synthase
    • 3-oxoacyl-(acyl carrier protein) synthase III
    • 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII
    • 3-oxoacyl--(acyl carrier protein) synthase II
    • 3-oxoacyl synthase III
    • 3-oxoacyl- synthase ,KASIII
    • 3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1 (3-oxoacyl-[acyl-carrier-protein] synthase III protein 1) (Beta-ketoacyl-ACP synthase III 1) (KAS III 1) (bFabH1)
    • putative 3-oxoacyl-[acyl-carrier-protein]synthase III
  • strand?: +
  • coordinates?: 3510158..3511099
  • synteny block?: BlockID0022190
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0987 (fabH)
    N315:
    SA0842 (FabH)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0938
    08BA02176:
    C248_1006 (fabH)
    11819-97:
    MS7_0938 (fabH)
    71193:
    ST398NM01_0979
    ECT-R 2:
    ECTR2_838 (fabH)
    ED133:
    SAOV_0929
    ED98:
    SAAV_0944 (fabH)
    HO 5096 0412:
    SAEMRSA15_08120 (fabH)
    JH1:
    SaurJH1_1001
    JH9:
    SaurJH9_0982
    JKD6008:
    SAA6008_00936 (fabH)
    JKD6159:
    SAA6159_00839 (fabH)
    LGA251:
    SARLGA251_09000 (fabH)
    M013:
    M013TW_0905
    MRSA252:
    SAR0946 (fabH)
    MSHR1132:
    SAMSHR1132_08310
    MSSA476:
    SAS0853
    Mu3:
    SAHV_0978 (fabH)
    Mu50:
    SAV0983 (fabH)
    MW2:
    MW0865 (fabH)
    RF122:
    SAB0848 (fabH)
    ST398:
    SAPIG0979
    T0131:
    SAT0131_01016 (atpE)
    TCH60:
    HMPREF0772_12262 (fabH)
    TW20:
    SATW20_09820 (fabH)
    USA300_TCH1516:
    USA300HOU_0941 (fabH1)
    VC40:
    SAVC_04085

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNVGIKGFGAYAPEKIIDNAYFEQFLDTSDEWISKMTGIKERHWADDDQDTSDLAYEASL
    N315            MNVGIKGFGAYAPEKIIDNAYFEQFLDTSDEWISKMTGIKERHWADDDQDTSDLAYEASV
    NCTC8325        MNVGIKGFGAYAPEKIIDNAYFEQFLDTSDEWISKMTGIKERHWADDDQDTSDLAYEASL
    Newman          MNVGIKGFGAYAPEKIIDNAYFEQFLDTSDEWISKMTGIKERHWADDDQDTSDLAYEASL
    USA300_FPR3757  MNVGIKGFGAYAPEKIIDNAYFEQFLDTSDEWISKMTGIKERHWADDDQDTSDLAYEASL
                    ***********************************************************:

    COL             KAIADAGIQPEDIDMIIVATATGDMPFPTVANMLQERLGTGKVASMDQLAACSGFMYSMI
    N315            KAIADAGIQPEDIDMIIVATATGDMPFPTVANMLQERLGTGKVASMDQLAACSGFMYSMI
    NCTC8325        KAIADAGIQPEDIDMIIVATATGDMPFPTVANMLQERLGTGKVASMDQLAACSGFMYSMI
    Newman          KAIADAGIQPEDIDMIIVATATGDMPFPTVANMLQERLGTGKVASMDQLAACSGFMYSMI
    USA300_FPR3757  KAIADAGIQPEDIDMIIVATATGDMPFPTVANMLQERLGTGKVASMDQLAACSGFMYSMI
                    ************************************************************

    COL             TAKQYVQSGDYHNILVVGADKLSKITDLTDRSTAVLFGDGAGAVIIGEVSDGRGIISYEM
    N315            TAKQYVQSGDYHNILVVGADKLSKITDLTDRSTAVLFGDGAGAVIIGEVSEGRGIISYEM
    NCTC8325        TAKQYVQSGDYHNILVVGADKLSKITDLTDRSTAVLFGDGAGAVIIGEVSDGRGIISYEM
    Newman          TAKQYVQSGDYHNILVVGADKLSKITDLTDRSTAVLFGDGAGAVIIGEVSDGRGIISYEM
    USA300_FPR3757  TAKQYVQSGDYHNILVVGADKLSKITDLTDRSTAVLFGDGAGAVIIGEVSDGRGIISYEM
                    **************************************************:*********

    COL             GSDGTGGKHLYLDKDTGKLKMNGREVFKFAVRIMGDASTRVVEKANLTSDDIDLFIPHQA
    N315            GSDGTGGKHLYLDKDTGKLKMNGREVFKFAVRIMGDASTRVVEKANLTSDDIDLFIPHQA
    NCTC8325        GSDGTGGKHLYLDKDTGKLKMNGREVFKFAVRIMGDASTRVVEKANLTSDDIDLFIPHQA
    Newman          GSDGTGGKHLYLDKDTGKLKMNGREVFKFAVRIMGDASTRVVEKANLTSDDIDLFIPHQA
    USA300_FPR3757  GSDGTGGKHLYLDKDTGKLKMNGREVFKFAVRIMGDASTRVVEKANLTSDDIDLFIPHQA
                    ************************************************************

    COL             NIRIMESARERLGISKDKMSVSVNKYGNTSAASIPLSIDQELKNGKIKDDDTIVLVGFGG
    N315            NIRIMESARERLGISKDKMSVSVNKYGNTSAASIPLSIDQELKNGKLKDDDTIVLVGFGG
    NCTC8325        NIRIMESARERLGISKDKMSVSVNKYGNTSAASIPLSIDQELKNGKIKDDDTIVLVGFGG
    Newman          NIRIMESARERLGISKDKMSVSVNKYGNTSAASIPLSIDQELKNGKIKDDDTIVLVGFGG
    USA300_FPR3757  NIRIMESARERLGISKDKMSVSVNKYGNTSAASIPLSIDQELKNGKIKDDDTIVLVGFGG
                    **********************************************:*************

    COL             GLTWGAMTIKWGK
    N315            GLTWGAMTIKWGK
    NCTC8325        GLTWGAMTIKWGK
    Newman          GLTWGAMTIKWGK
    USA300_FPR3757  GLTWGAMTIKWGK
                    *************